KEGG   Drosophila persimilis: Dper_GL20388Help
Entry
Dper_GL20388      CDS       T01063                                 

Definition
GL20388 gene product from transcript GL20388-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dpe  Drosophila persimilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dper_GL20388
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dper_GL20388
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dper_GL20388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MLGSRNLASRCVRLARSKTTTSSSSRAKASVVAEQSRGIIGVPFAKGQGKQGVELAPDLL
RQSNLRQVLQSSHDGLVIRDYGNLQYAVDETLLQQQRVHYHHIRNYADFMACNRALIEQV
KIMLQQNSQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMP
VSFLLEQLRTTWQHACLDEIAPNCLPKDQLVYIGLRDIDPYEAFILNKFGIRYYAMDTID
RVGVPKIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRD
TKRVQGVDLVEINPKLGNERDVRTTVDSGLEILKSMFGYRRSGHWSNIDTGILGSD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttggggagtcgaaacttagcctcaaggtgtgtgcgcctggcgcgctcgaagaccacc
accagcagcagctccagggctaaggcatccgtagtggccgaacagagtcggggcatcatc
ggggtgccctttgccaagggccagggcaagcagggcgtcgagcttgcaccggacctgctg
cgtcagagtaatctgcgtcaagtgctccagagcagtcacgatggactggtgatccgggac
tatggaaacctgcagtatgccgtggatgagacgctgttgcagcagcagcgcgtccactac
catcacatccgcaactacgccgacttcatggcctgcaaccgggccctgatcgagcaggtg
aagataatgttgcagcagaactcccagtttctggccattggcggggaccatgccatcggt
ttcggttctgtggccggtcatctgcagcatacaccgaatctgtctctggtgtggatcgac
gcgcatgcggatattaatctgcacagcacctcgcagtcgggcaacatacatgggatgccc
gtctcgtttctgctggagcagctccgcaccacctggcagcatgcgtgcctcgacgagatc
gctcccaactgtttgccgaaggatcagttggtttacattggactgagggacattgacccc
tacgaggcgttcatattgaataaatttggaatacgctactatgctatggatacaatcgat
cgcgtgggtgtgccgaaaatcatcgagatgaccctggatgctctgaatccacagaacaag
atccacgttagcttcgacatcgatgcgcttgacagcaacgtggcgcccagcactggcaca
gccgttcgcggcggtctcacgttgcgcgagggcatcagtattgtggaggcgttgcgggac
acaaagagggtgcagggtgtagacctggtggagatcaatccaaagctgggaaatgaacgc
gacgtacgcaccaccgtcgactccggcctggagatcctcaagagcatgttcggctatcgg
cgctctggccactggagtaacatcgatacgggaatcctgggaagcgattga

DBGET integrated database retrieval system