KEGG   Drosophila persimilis: Dper_GL20446Help
Entry
Dper_GL20446      CDS       T01063                                 

Definition
GL20446 gene product from transcript GL20446-RA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dpe04013]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dpe04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpe04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpe04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dpe04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 375 aa AA seqDB search
MAEANAAGTSVEGAVGLLAPHPNAELIRGQIFEVGPRYTKLAYIGEGAYGMVVSADDTIT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSREDLECIINEKARNYLESLPFKPNVPWSRLFPNADPLAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEVAEVPFRINMENDDISRDALKSLIF
EETLKFKERQPEQAI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcaaatgctgctggaacaagtgtggaaggtgctgttggtttgctagccccg
caccctaatgctgaactaataaggggtcaaatttttgaagtgggtcccagatataccaaa
ttagcttacattggcgaaggagcttacggcatggtggtatctgccgatgacacgataaca
aaccaaagagttgcaattaaaaaaatttcgccgtttgaacaccaaacgtattgtcaaaga
acactcagagagataaccatcctgacccgatttaaacatgaaaacattattgatatacga
gacatcttgcgagtagatagtatagaacagatgagggatgtttatattgtacagtgttta
atggagactgatttgtataaactacttaaaactcagaggctcagtaatgaccatatctgc
tacttcctgtatcaaatattacgaggattgaagtacattcattcagcaaacgttttacat
cgggatttaaagccaagcaatctattgttgaataagacgtgtgatttaaaaatttgcgat
tttggattagcccgaattgcagatcctgagcacgaccatactggcttcctaacagaatat
gttgctactcggtggtatcgcgcacctgaaattatgctcaattccaagggatacacaaaa
tctattgatatctggtccgttgggtgcattttggctgaaatgttaagtaatcgaccaata
ttccctggaaaacattatctggaccaactaaatcatattcttggtgtcttgggatctcca
tcgcgcgaagatttagagtgcattattaatgaaaaggcacgtaactatttggagtctttg
ccttttaagccaaatgttccatggtcgagacttttcccaaatgccgatcccttggcttta
gatcttcttggaaaaatgttgacatttaatccgcacaaaagaattccagttgaagaagcc
cttgcacatccctacttagagcagtattatgaccctggagatgaggttgccgaagtacca
tttcgcataaatatggaaaatgacgatatatctcgagacgccttaaagtcattgattttc
gaagaaactttgaaatttaaagaacgacagccagaacaagcaatttaa

DBGET integrated database retrieval system