KEGG   Drosophila persimilis: Dper_GL20446Help
Entry
Dper_GL20446      CDS       T01063                                 

Definition
GL20446 gene product from transcript GL20446-RA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dper_GL20446
   04350 TGF-beta signaling pathway
    Dper_GL20446
   04068 FoxO signaling pathway
    Dper_GL20446
   04150 mTOR signaling pathway
    Dper_GL20446
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dper_GL20446
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dper_GL20446
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dper_GL20446
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL20446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 375 aa AA seqDB search
MAEANAAGTSVEGAVGLLAPHPNAELIRGQIFEVGPRYTKLAYIGEGAYGMVVSADDTIT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSREDLECIINEKARNYLESLPFKPNVPWSRLFPNADPLAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEVAEVPFRINMENDDISRDALKSLIF
EETLKFKERQPEQAI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcaaatgctgctggaacaagtgtggaaggtgctgttggtttgctagccccg
caccctaatgctgaactaataaggggtcaaatttttgaagtgggtcccagatataccaaa
ttagcttacattggcgaaggagcttacggcatggtggtatctgccgatgacacgataaca
aaccaaagagttgcaattaaaaaaatttcgccgtttgaacaccaaacgtattgtcaaaga
acactcagagagataaccatcctgacccgatttaaacatgaaaacattattgatatacga
gacatcttgcgagtagatagtatagaacagatgagggatgtttatattgtacagtgttta
atggagactgatttgtataaactacttaaaactcagaggctcagtaatgaccatatctgc
tacttcctgtatcaaatattacgaggattgaagtacattcattcagcaaacgttttacat
cgggatttaaagccaagcaatctattgttgaataagacgtgtgatttaaaaatttgcgat
tttggattagcccgaattgcagatcctgagcacgaccatactggcttcctaacagaatat
gttgctactcggtggtatcgcgcacctgaaattatgctcaattccaagggatacacaaaa
tctattgatatctggtccgttgggtgcattttggctgaaatgttaagtaatcgaccaata
ttccctggaaaacattatctggaccaactaaatcatattcttggtgtcttgggatctcca
tcgcgcgaagatttagagtgcattattaatgaaaaggcacgtaactatttggagtctttg
ccttttaagccaaatgttccatggtcgagacttttcccaaatgccgatcccttggcttta
gatcttcttggaaaaatgttgacatttaatccgcacaaaagaattccagttgaagaagcc
cttgcacatccctacttagagcagtattatgaccctggagatgaggttgccgaagtacca
tttcgcataaatatggaaaatgacgatatatctcgagacgccttaaagtcattgattttc
gaagaaactttgaaatttaaagaacgacagccagaacaagcaatttaa

DBGET integrated database retrieval system