KEGG   Drosophila persimilis: Dper_GL20751Help
Entry
Dper_GL20751      CDS       T01063                                 

Definition
GL20751 gene product from transcript GL20751-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL20751
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL20751
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL20751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 532 aa AA seqDB search
MMSGGNDHAVEHYRVTNYPLAVKLGTITADGKSDVFSYPEDDMVIDPHLEKHLSHFGINM
AAMKKSEKSMVELELEINQRIGEWSALTESDSELQPMAGPGYTGMRNLGNSCYINSVMQV
LFVIPDFQERFVGTGAERYFSEFPSDPANDFNIQMAKLGNGLQSGKYSSIVENTLDTDNL
SGISPAMFKNIVGKNHPEFSTKQQQDANDFYLHLLTMLDRNSRNQSNPADALKFLLEDRV
ECLASRKVKYKKREEYSFRLPIPLEKATNLEEVREYQERDQAARESGQRLVDRDIVRHKV
PLRACLERFFGTELIEQFYSTAINGKTNAEKTTRMATMPDFLMIHLGKFTLGDDWVPKKL
DVSVDMPDDLDLSAWKSTGGGLKPGEEPLPEPAAEQPKFTFDEAVMSELLNMGFPHEACK
RACFHTKNSGLEAASNWLMEHIADEDISDPFEVPNNSIGDCASEQFVANPESLAMLMSMG
FDERQACHESHVAAKVATEMPKIYVKKPLAGLVIRNRAHKSSSIFTFRSPCE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcggtggcaacgatcacgctgtggagcactatcgcgttaccaactatccgctg
gccgtcaagctgggcaccatcaccgccgacggcaagtccgatgtgttctcctacccggag
gacgacatggtcatcgatccgcacctggagaagcatctctcccactttggcatcaatatg
gcggccatgaagaagagcgagaaatcgatggtcgagctggagctggagataaaccagcgc
atcggcgaatggtcggccctgaccgagagcgatagtgagctgcagcctatggccggaccg
ggatacacaggaatgcggaatttgggcaatagctgctacatcaacagcgtgatgcaggtg
ctctttgtcattcctgacttccaggagcgttttgtcggcaccggggctgagcgctacttt
agtgagttccccagcgatccggcgaacgacttcaacatacagatggccaagctgggcaac
ggcctccagtcgggcaagtacagcagcatcgtcgagaacacactggacacggataacttg
tcgggcatatcgccggccatgttcaagaacattgtaggcaagaaccatccggagttcagt
accaagcagcagcaggatgccaacgacttctatctgcatttgcttacgatgctcgatcgc
aattcgcgcaatcaatcgaatccggcggatgccctgaagttcctgctggaggatcgcgtg
gagtgcctggccagccgcaaggtcaagtacaagaagcgcgaggagtacagcttccggctg
cccataccgctggagaaggccaccaatctggaagaggtcagggagtatcaggagcgggac
caggcagcccgcgagagcggacagcgtctcgtcgatcgcgacattgtccgtcacaaggtg
ccgctgcgggcctgcctggagcgcttcttcggcacggagctcatcgagcagttctactcg
acggccatcaatggcaaaacgaacgcagagaagaccacacgcatggccaccatgcccgac
ttcctcatgatccatctgggaaagttcacgctgggcgacgactgggtgcccaagaagctg
gacgtctccgtggacatgcccgacgatctggatctgagcgcctggaagtccaccggcggt
ggcctaaagcctggtgaggagccactgcccgaaccggccgccgagcagcccaaattcacg
ttcgacgaggcggtcatgtcggagttgcttaatatgggctttccccatgaggcctgcaag
cgggcctgtttccacaccaagaacagcggcctggaggccgcctccaactggctaatggag
cacattgccgacgaggacatctccgatccgtttgaggtgcccaacaatagcatcggcgac
tgcgccagcgagcagtttgtggccaatccggaaagcctggctatgctcatgagcatggga
ttcgatgaacgccaggcctgccacgagagccacgtagccgcaaaagttgccaccgagatg
cccaagatctacgtaaagaagcccttggcgggcctggtcatacggaatcgggcccacaag
agcagcagtatcttcacgttccgttccccgtgcgagtaa

DBGET integrated database retrieval system