KEGG   Drosophila persimilis: Dper_GL20800Help
Entry
Dper_GL20800      CDS       T01063                                 

Definition
GL20800 gene product from transcript GL20800-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dpe  Drosophila persimilis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dper_GL20800
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dper_GL20800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 221 aa AA seqDB search
MISFLFIVNRALSSSSRKMSQGPRPLVLCGPSGSGKSTLLKLLFAEFPNTFGFSVSHTTR
KPREGEEDGVHYYFVERADMEEAIANDEFIETAEFTGNLYGTSKAAVREIQKKGRVCILD
IEQKGVEQIRKTDLNPILIFNNPPTIQELERRLRLRGSETEETLRKRLNAAEVEISYGLT
PGNFHKIINNVDIEAAYTEFRDFVVHELKQQEYDGISISLN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattagctttctgttcattgtaaaccgcgcactcagcagcagcagccgcaaaatgtcg
caaggcccacgtccgcttgtactctgcggcccctccggttccggaaagagcacgctgctc
aagctattgtttgcagagttcccaaacacatttggattcagcgtctcccacaccacgaga
aaaccgcgtgagggcgaggaagatggtgttcactattattttgtggagagagccgacatg
gaggaggcgatcgccaatgacgagttcattgagacggccgagttcaccgggaatctatac
ggcaccagcaaggcggccgtacgcgagattcagaagaagggacgcgtctgcatactggac
attgagcagaagggagtggagcagattcggaaaaccgatctcaatcccatactgatcttc
aacaatccgccaaccatccaagagctggagcgtcgactgcgactacgtggctccgagacc
gaggagacgttgcgcaagcgactcaatgccgccgaggtggagatcagctacggcctgacg
ccgggaaacttccacaagatcatcaacaacgtggacatagaggcggcctacacagagttt
cgcgatttcgttgtccatgagttgaagcagcaggagtacgatggcatcagcattagcctc
aattaa

DBGET integrated database retrieval system