KEGG   Drosophila persimilis: Dper_GL20800Help
Entry
Dper_GL20800      CDS       T01063                                 

Definition
(RefSeq) GL20800 gene product from transcript GL20800-RA
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dpe  Drosophila persimilis
Pathway
dpe00230  Purine metabolism
dpe01100  Metabolic pathways
Module
dpe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dper_GL20800
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dper_GL20800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 ABC_tran AAA_16 AAA_18 AAA_21 RsgA_GTPase AAA_29 ATPase_2 MMR_HSR1 RNA_helicase AAA_5 Rad17 AAA_14 AAA Pox_A32 AAA_23 T2SSE AFG1_ATPase NACHT AAA_24 AAA_28 Gtr1_RagA cobW Cytidylate_kin DUF5417 AAA_30
Motif
Other DBs
NCBI-GeneID: 6600509
NCBI-ProteinID: XP_002025616
FlyBase: FBgn0158395
UniProt: B4H437
AA seq 221 aa AA seqDB search
MISFLFIVNRALSSSSRKMSQGPRPLVLCGPSGSGKSTLLKLLFAEFPNTFGFSVSHTTR
KPREGEEDGVHYYFVERADMEEAIANDEFIETAEFTGNLYGTSKAAVREIQKKGRVCILD
IEQKGVEQIRKTDLNPILIFNNPPTIQELERRLRLRGSETEETLRKRLNAAEVEISYGLT
PGNFHKIINNVDIEAAYTEFRDFVVHELKQQEYDGISISLN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattagctttctgttcattgtaaaccgcgcactcagcagcagcagccgcaaaatgtcg
caaggcccacgtccgcttgtactctgcggcccctccggttccggaaagagcacgctgctc
aagctattgtttgcagagttcccaaacacatttggattcagcgtctcccacaccacgaga
aaaccgcgtgagggcgaggaagatggtgttcactattattttgtggagagagccgacatg
gaggaggcgatcgccaatgacgagttcattgagacggccgagttcaccgggaatctatac
ggcaccagcaaggcggccgtacgcgagattcagaagaagggacgcgtctgcatactggac
attgagcagaagggagtggagcagattcggaaaaccgatctcaatcccatactgatcttc
aacaatccgccaaccatccaagagctggagcgtcgactgcgactacgtggctccgagacc
gaggagacgttgcgcaagcgactcaatgccgccgaggtggagatcagctacggcctgacg
ccgggaaacttccacaagatcatcaacaacgtggacatagaggcggcctacacagagttt
cgcgatttcgttgtccatgagttgaagcagcaggagtacgatggcatcagcattagcctc
aattaa

DBGET integrated database retrieval system