KEGG   Drosophila persimilis: Dper_GL21056Help
Entry
Dper_GL21056      CDS       T01063                                 

Definition
GL21056 gene product from transcript GL21056-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dper_GL21056
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dper_GL21056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 729 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSSSRLDLPQLCNGSRRGLDGHNNHVAVNEAVTTTTSLN
GNSNSSHNNNNIGSPVSSSTTNSSSNGGNERGSSTKSNSSSGSGSSGNSASSTGSGELKC
NTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDN
GNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVEL
NILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRR
FCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRF
YRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLIS
VARRRRLFFDSRDAPRCITNTKGRKRAPGSKSLAQILHCQDRYFIDFLQRCLEWDPAERM
TPDEAAHHEFLQPSTSSRHRSCRMSSSSSSSGLNSVSQKSSCYNFAEISPGSGGPVVASI
TSTTAVSNAAITTTKSRQPQQQQQQQSHSHSNHINHTSHSHAQSNGHLPDIKLSAGDKYN
SMQKVAVRSKITSSVSDLESVQQYSLHRIYGGVGTGQHPPRLLGGPPGKHLNGVSNVSAS
SKYGSSTLAHNHHNVNHHNASTATLATATHHHHHHAAVGQPVSNGAASGAMSHSQSTGDV
SDRAIFGRA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgcgaaatgccgatccagctggacaatgagaagctgcgacgagatgtg
cggctctccagctcccgcctggacctgcctcagctctgcaatgggtcgcggcgcggcctg
gatggccacaacaaccatgtggcagtgaatgaggccgtcaccacaacgacgtccctcaat
ggcaacagcaacagcagccacaacaacaacaacattggctcccccgtctcctcgtcgacc
accaacagcagcagcaacggtggcaacgagcgcggctcctccaccaagtccaacagcagc
agcggcagcggcagctccggcaactcggccagcagcacaggcagcggcgagcttaagtgc
aacacgcccatgacgccatctgagctggttaagaagttccgcaactacctgaccgatctg
gagttcgaggagctcaaggtgtacaaggaggtctggtactttggccagcacgccagcaag
aactacaacaagcccgcccccacagccaacaccacgaatctgggctatgacgacgataat
ggcaactacaagatcatcgaacacgatcacatagccttccgttacgagattttggaggtg
attggcaagggcagcttcgggcaggtgatcagggccctagaccacaagaccaacacacac
gtggccatcaagatcataaggaacaagaagcgcttcctcaaccaggccgttgtcgagctg
aatatcctcgacgagttgcgcgaaaaggacgcggatggatctcacaatgtcatccacatg
ctggactacacatatttccgcaaacatttgtgcattaccttcgagctgatgagcttgaac
ctgtacgagctgatcaagaagaacaactacaatggattcagcatgagtctgatccgacgc
ttctgcaactcgattgtaaagtgcctgcgactgctctacaaggaaaacatcattcactgt
gatctcaagccggaaaacatcttgctcaaacagcgcggcagcagctccatcaaagtgatc
gacttcggcagctcctgctatgtggatcgcaagatctatacctacatccagtcgaggttc
tatcgctccccggaggtgattctgggcctgcagtatggcacggccatcgacatgtggagc
ctgggctgcatactggccgagctgtacacgggattcccgctcttccccggcgagaacgag
gtggagcagctggcctgcatcatggaggtgctggggctgccgccgaaggtgctcatttcg
gtggccaggcgtcggcgtctgttcttcgactcgagggatgcgccgcgctgcatcacaaac
accaaggggcggaagagggccccgggtagcaagtcactggcccagatcttgcactgccag
gatcggtacttcattgacttcctgcagcgctgcctggagtgggatcccgcggagcggatg
acgcccgacgaggcggcccaccacgaattcctacagccctccacctccagtcgccatcgc
agctgccgcatgtcgagcagctcctccagctcgggcctgaacagcgtctcccagaagtcc
tcctgctacaacttcgcagagatctcaccaggcagcggagggcccgtggtcgcgtccatc
accagcaccactgcagtaagcaatgcggccatcaccaccaccaagtctagacagccgcag
caacagcagcagcagcagagtcacagccacagcaaccacatcaaccacacgagccacagt
cacgcccagtcgaatggacacctgcccgacatcaagctgagcgccggcgataagtacaac
agcatgcagaaggtggcggtgcgctccaagatcacctcaagcgtctccgacctggagtcc
gtgcagcagtactcgctgcaccgcatatacgggggcgtgggcaccgggcagcacccacca
cgtctcctcggcgggccaccaggaaagcatctgaacggggtcagcaacgtgagcgcgtct
tccaaatacggcagctcgacactggcgcacaaccatcacaatgtgaaccaccacaacgcg
tcgacggccacgcttgccacggccacccaccatcaccatcaccacgcagcagtcggccag
ccggtgagcaatggtgcggccagtggcgccatgtcgcactctcagtccactggcgatgtc
tccgacagagccatctttgggagggcttga

DBGET integrated database retrieval system