KEGG   Drosophila persimilis: Dper_GL21224Help
Entry
Dper_GL21224      CDS       T01063                                 

Definition
GL21224 gene product from transcript GL21224-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpe04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 343 aa AA seqDB search
MPKFYKLDINRTEWEIPETYQSLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVH
AKRTYRELRLLKHMEHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQK
LSDDHVQFLIYQILRGLKYIHSAGVIHRDLKPSQHRESEMTGYVATRWYRAPEIMLNWMH
YNKTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPAEEFMSRISSESARNYI
RSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADQRITAEQALAHPYMEKYHDPTDEQT
AALYDQSFEENELPVEKWREMVFTEVQAFRPTQAFAELLPKDL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagttctacaagctagacataaatcgcacggagtgggagataccagagacatac
caaagccttcagcccgtcgggcagggggcctacggtcaggtgtgcaaggctgttgtccga
ggaaccagcacaaaggtagcgataaagaaactggcgcggccctttcagtcggccgtgcat
gccaagcgaacgtaccgtgagctgcgcctactgaagcacatggagcacgagaatgtgatt
ggtctcctggacgttttccatcccggacagcccgccgactcgctggaccagttccagcag
gtctacatggtgacgcatctcatggacgcggacctcaacaacataatacgcacgcagaag
ttgtctgacgaccacgttcagttcctgatataccaaatcctaagaggcttgaagtatatt
cacagtgccggggtgatacatcgcgatttgaaaccgtcccaacatcgcgaaagcgagatg
actggctatgtggccacgagatggtatcgggcaccggaaatcatgctcaactggatgcac
tacaacaagacggtggacatttggtctgtgggatgcatcatggccgagctcttgaccgga
cgcaccctcttccccggcaccgatcacattcatcagctgaacctgatcatggaagtgctg
ggcacgccggcggaggagtttatgagccgcatctcctcggagagtgccagaaactacata
cggtcgttgccagtgatgccgagacgaaactttcgagacatctttcgtggggccaatccg
ctggcgatcgacctgctggagaagatgctcgagctagatgccgaccagcgcatcacagcc
gagcaggcgttggcccatccctatatggagaagtaccatgaccccaccgacgagcagaca
gcggccttgtacgaccagagcttcgaggagaacgagttgcccgtggagaagtggagggaa
atggtgttcaccgaggtgcaagccttcaggcccactcaggccttcgccgagctcctgccg
aaggatttataa

DBGET integrated database retrieval system