KEGG   Drosophila persimilis: Dper_GL21233Help
Entry
Dper_GL21233      CDS       T01063                                 

Definition
(RefSeq) GL21233 gene product from transcript GL21233-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 589 aa AA seqDB search
MLASETFPAHRFKESIFKPYSTSGSASVDDLASVNKTLTSAATTSSSPDTHAAVDIAPTA
SSVEFETARKMLTNNSSSSSNNSNNNNNNNNNDAKDDISGFVASHPAAPFEGFIRACVDE
IIKLAVFQGTNRSTKVVEWHEPAELRQLFDFQLRDKGEPQEKLRELLRETIRFSVKTGHP
YFINQLYSGVDPYALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGKG
DGIFCPGGSIANGYAISCARYTYAPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFG
SEHVVKIATNEVGKMRLSDLEDQVRRCLDNGWQPLMVSATAGTTVLGAFDDLTGIGDLCR
KYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQLVL
GQCHSTNAAYLFQKDKFYDTSYDTGDKHIQCGRRADVFKFWFMWKAKGNLGLESHVEKVF
RMAEFFTAKVRERPGFELVLESPECTNISFWYVPPSLRTMERDREFYDKLHKVAPKVKER
MIKKGSMMITYQPLRQLPNFFRLVLQNSCLEESDMIYFLDEIESLAKNL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgctggccagtgagacttttcccgcacatcgcttcaaggaatctatatttaagccttac
agcacgagtggctcggccagcgtcgatgatttggcaagcgttaacaaaacattgacatcc
gcggcgaccacgtcgtcatcgcctgatactcatgcagccgttgacatcgcgcccactgca
tcctcagtcgagttcgagactgcccgcaaaatgttgaccaacaacagcagtagcagtagc
aataacagtaacaataataacaacaataacaataacgatgccaaggatgatatatctggt
ttcgtggccagccatccggcagccccattcgagggcttcatccgtgcctgcgtcgacgag
attatcaagttggccgtcttccagggtaccaaccgatccaccaaagtcgtggagtggcac
gagcccgccgagctccgccagctcttcgacttccagctgcgcgacaaaggggagccgcag
gagaagctacgagagcttctgcgcgagaccatacggttctcggtgaagaccggacatccg
tacttcatcaatcagctgtattcgggcgtggatccctacgccctggttggccagtggctc
accgacgccctgaaccccagtgtctacacgtacgaagtggcgcctctgttcacgctgatg
gaggagcaggtgctggccgagatgcgtcgcattgtgggcttccccaatgggggcaagggc
gacggcatcttctgtcctggcggttcgatagccaacggttatgcaatcagctgtgcgcgc
tacacatacgcgcccgagtccaagaaaaacggactcttcaatgccaaacctttgattata
ttcacatcggaggatgcgcattattcggtggagaaattggccatgttcatgggtttcgga
agcgagcatgtggtcaagatagcgaccaatgaggtgggcaagatgcgtctgagcgatctg
gaggatcaggttcggcggtgcctggacaatggctggcagcctctgatggtctcggccacg
gccggcaccacggttctgggcgccttcgatgacttgacagggatcggggatctgtgcagg
aagtacaacatgtggatgcacgtagatgcggcatggggaggcggtgcgctgatgtctaag
aagtatcgccatctgctgaacggcatcgaacgggctgattcggtgacgtggaacccccac
aagttgttggccgcctcgcagcagtgctccacctttctgacacgccaccagctggtcttg
ggccagtgccactccaccaatgcggcgtacctgttccagaaggacaagttctatgacacc
tcctacgacactggggacaagcacatccagtgcggacgcagggcggacgtcttcaagttc
tggttcatgtggaaggctaaaggcaacctgggcctggagtcgcatgtggagaaggtcttt
cgcatggccgagttcttcaccgccaaggtccgagagcggcccggcttcgaattggttctg
gagagtcccgagtgcaccaacatcagcttctggtacgtgccccccagtctccggacgatg
gagcgagatcgggagttctacgacaagctgcacaaggtggcgcccaaggtcaaggagcgg
atgataaagaagggctccatgatgatcacatatcagccgctgcgccagctcccgaacttc
ttccgtctggtgcttcaaaactcgtgtctggaggagtcggatatgatctacttcctcgat
gagatcgagtccctggccaagaacttgtag

DBGET integrated database retrieval system