KEGG   Drosophila persimilis: Dper_GL21266Help
Entry
Dper_GL21266      CDS       T01063                                 

Definition
GL21266 gene product from transcript GL21266-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dpe  Drosophila persimilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dper_GL21266
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dper_GL21266
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dper_GL21266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 867 aa AA seqDB search
MALGRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIGGIGGGTIGRGFAGEFCRFQMR
PGIYEYNVVQANQFIVTIKDQKGCTIFQSLLSKCSTMSRGNNGSDPDADGEKTKCQLPNC
SSRPKQPLSAWHSNIEDARCSYTGLYPRSWTEYDLSHYGVRLVCRQVSPVIPHEYRDSSL
PCAVFVWSVENVCDQERIVSITFSFKNGTGNKKQDAEGGAESQLISAGNAKGVAIRQKIA
DMPCSYNLACRVLPEISITRCPQFDPAGSGEQLWAQLKEHGQLSEQPTGETLKTKDIGVA
VCAQLALKPQASHDLEFVLAWDMPRIQFPRKMQTHMRYYTKYFDDSGESGPKICEYALKQ
YPSWERLIDAWQRPILSDDTLPDWYKCAIFNQLYFISDGGTIWLKCDSSLGKELAYDDPR
LAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVSLQYDFKDAIAAELSDTRKML
YDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNTKFVLQVYRDYYVLNE
LAQSQADNASKFSSIEFIDKESLYEMYTQDNKRKNSSDEKQQNRKSASMYINETNGKVYL
MDAIGYLKAMYGACKAIMERTIEYDKDNDGLIENTKMPDQTYDSWVMDGPSAYCSGLWLA
ALQAMSAMATILDQPNDCLRFQDILEKGKRSLEEKLWNGSYYRFDLSPSHRDSIMADQLC
GHWYLKSCGFDYEIYPKENVRTALKTIYDNNVMGFHEGNIGAANGFIANAADPSKPGHVD
NSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKTLSERIGMNFETPEALYGEKR
YRSIGYMRPLSIWSMQVALERRRALRD
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgggacgatatgcggcctactactggaaagtgtcgcgtgaaggtcgtcgagtg
tacatggactactactacatggagaacggaaagcagatttatggcgtgcccatcggcggg
ataggcggaggcaccattggacggggctttgcgggcgagttttgtcgcttccagatgcgt
cccggcatctatgagtacaatgtggtgcaggccaaccagtttatagtgaccatcaaagat
cagaagggctgcaccatctttcaaagtctactctccaagtgcagcaccatgtcgaggggc
aacaacggcagcgatccggatgccgatggggagaaaactaaatgtcaactgcccaattgc
agcagccgccccaagcagccgctgagtgcctggcactccaacatcgaagacgcacggtgc
agctacacgggcctgtacccccgctcctggaccgagtacgatctctcccactatggggtt
cgactggtgtgtcgccaggtctcgcccgtcatcccgcacgagtaccgggactccagcctg
ccgtgtgctgtctttgtgtggagtgtggagaacgtatgcgatcaggagcgcatagtctcc
atcacgttctccttcaagaacggcacgggcaacaagaagcaggacgccgagggtggggcc
gagtcgcagctgatcagcgcaggcaatgcaaagggcgtcgccattcgccagaagatcgcc
gacatgccgtgcagctacaacctggcctgtcgcgtcctgccagagatcagcatcacgcgc
tgtccccagttcgacccggctggcagcggagagcagctgtgggctcagctgaaggagcac
ggccagctcagtgagcagcctaccggggaaaccctaaaaaccaaagacataggcgtcgct
gtctgcgcccaactagccctcaagccccaggcctcgcacgatctggagtttgtcctggcg
tgggacatgcccaggattcagttccccaggaagatgcagacgcacatgcgctactacacc
aaatactttgacgacagcggcgaatcgggaccaaagatatgcgagtatgctctgaagcag
taccccagctgggagcgactaattgatgcctggcagcggcccatactcagcgatgatact
ctacccgactggtacaagtgcgccatattcaatcagctctactttatctcagacggggga
accatctggctgaagtgcgactcatcgctgggcaaggagctggcctacgacgatccgcgg
ctggcctatgggcgtttcggctacttggaggggcacgagtatcggatgtacaacacctac
gatgttcacttctatgcctctccggcactggcccatctctggccaaacctgcaggtgagc
ctgcagtacgacttcaaggatgccattgcagccgagctgagcgacacccgaaagatgctg
tacgacggcaaagtgatgccgcgcaaggtcaagaactgtgtgccccatgatctgggcgat
cccgatgaagaaccctttaccctgatcaattgctataacattcacgatgtaaacgattgg
aaggatctcaataccaagtttgtgctgcaggtctacagggactactatgtcctgaatgaa
ctggcccagtcacaagcggacaatgctagcaagtttagctccattgagttcatcgacaag
gaaagcctgtacgaaatgtacacgcaggacaacaagcgcaagaactcgtcggacgagaag
cagcagaatcgcaagtcagcctccatgtatatcaacgaaaccaatggcaaagtgtacctc
atggatgcgattggctatctgaaggcaatgtacggggcctgtaaggccatcatggagcga
accattgagtatgacaaggacaacgatggtcttatcgagaacaccaaaatgccggatcag
acctacgactcttgggtgatggacggacccagtgcgtactgctcaggcctgtggctggcc
gctctgcaggcaatgtcggccatggccaccattctggaccagccgaacgattgccttcgc
tttcaggacatcctggagaagggcaagcgatctctggaggagaagctttggaacggcagc
tactatcgcttcgatctctcgcccagccatcgggactcgattatggcggatcagctgtgc
ggccattggtatttaaaatcgtgtggctttgattacgaaatctatcccaaggagaatgtg
cgcacagctctcaagacgatctacgacaacaacgtgatgggcttccacgagggcaacatt
ggggcggccaacggcttcatagccaatgcggcagacccctccaagcctggccatgtggac
aatagcaatatccaagcagaggaggtgtggcccggagtggtctatgcccttgcagccacc
atgatacaggagggcatgttcgaggaagccttccagacggccggcggaatgtacaagacc
ctctcggagcgaatcggcatgaacttcgagacgcccgaggccctgtacggtgagaagcgc
tatcgctccattggctacatgcggccattgagcatctggtcgatgcaggtggcattggag
cggcgcagagcgctgcgagactaa

DBGET integrated database retrieval system