KEGG   Drosophila persimilis: Dper_GL21384Help
Entry
Dper_GL21384      CDS       T01063                                 

Definition
GL21384 gene product from transcript GL21384-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL21384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MKINNKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
IGISSAGAAGIGSAGAGGGGGGVGVGVTVGGSVTGSGGANVAGGVVSGAVVTTGGTVGGG
ELVNGNNVLAAALQKRFNRRRRVHGNTHGHHMPSQQPQHPQTPNAQVATPLHVTGDGLIP
TAPIEDGDGSQEGKIPTPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQEL
CQMPCIYICEFCLKYCKSRKCLERHLSQMQSSSSAGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaataacaaatacgagttcgacgacgacgtcgcatcaatatgcgagtcgacg
gctgcattgaccgagggctgccgcctgccggtgcgtatgcacaagacggatgactggccc
ttggcagagatcgttagcatcaaggagctggacggtcggcgtcagttttatgtccactat
gtagacttcaacaagcgcctagacgaatgggtcaacgaggaagatctgtacaccagaaag
gtgcagtttccccgtcgcgatggttctcagactggcaccagcacaggcgtaacaactccg
cagcgccatcactctctggccggtagtgtgtcgcgtcccacttcgccccagcatccgggc
attggaatcagctccgcaggggctgctggcattggcagtgccggtgccggtggtggtggc
ggaggcgttggcgttggcgttaccgttggcggcagtgtcactggtagtggaggagctaac
gttgcaggaggcgtagtcagcggtgccgtagtgactacaggtggcaccgtaggcggtgga
gagttggtcaacggcaacaatgtcctggctgctgctctgcagaagcgtttcaataggagg
cgcagggttcacggcaacacccatggccaccacatgccgtcgcaacagccgcagcatcca
caaacaccaaacgctcaggttgccacacctttgcatgtgacaggtgatggtctgattccc
accgcacccattgaagatggcgatgggtcgcaggaaggcaagattcccacgcccaggcag
tcgggcagcatggtcacacaccaggacgatgtggtcactcgcatgaagaacgtggaaatg
atcgagctgggccgccaccgcattaagccctggtacttctcgccctatccacaggagctc
tgccagatgccatgcatctacatctgtgagttctgcctcaagtattgcaagagtcgcaag
tgcctggagcgtcatctgtcccaaatgcaatcttcgtcatccgccgggcaatga

DBGET integrated database retrieval system