KEGG   Drosophila persimilis: Dper_GL21414Help
Entry
Dper_GL21414      CDS       T01063                                 

Definition
GL21414 gene product from transcript GL21414-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 58 aa AA seqDB search
PSGRFSYNESGLSCNNLLTDDITNSVRCAQKVLSQQEWSAWSTWKYCDGSLPSINDCF
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
cccagcggtcgcttctcctacaacgagagcggcctgagctgcaacaacctgttgaccgac
gacatcaccaactccgtgcgttgcgcccagaaggtcctctcccagcaggaatggtccgcc
tggtccacctggaagtactgcgacggctccctgccctccatcaacgactgcttctaa

DBGET integrated database retrieval system