KEGG   Drosophila persimilis: Dper_GL21414Help
Entry
Dper_GL21414      CDS       T01063                                 

Definition
(RefSeq) GL21414 gene product from transcript GL21414-RA
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dper_GL21414
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL21414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 58 aa AA seqDB search
PSGRFSYNESGLSCNNLLTDDITNSVRCAQKVLSQQEWSAWSTWKYCDGSLPSINDCF
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
cccagcggtcgcttctcctacaacgagagcggcctgagctgcaacaacctgttgaccgac
gacatcaccaactccgtgcgttgcgcccagaaggtcctctcccagcaggaatggtccgcc
tggtccacctggaagtactgcgacggctccctgccctccatcaacgactgcttctaa

DBGET integrated database retrieval system