KEGG   Drosophila persimilis: Dper_GL21486Help
Entry
Dper_GL21486      CDS       T01063                                 

Definition
GL21486 gene product from transcript GL21486-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL21486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1221 aa AA seqDB search
MDFITSMIKRPLSIRLTDANSSSSGSGLSSADSNPKDSPSALASMAVHPVVATEDLLQLG
DLEPLPSARESIQKLLLDVNVNLSQVSAHEMEHLQAMSAEMSPLAVKQSVRPSLEKQKAL
ATAMIIPPSEDLAIEPVAPRFGMFDEEQIPELAPLSAEMEAQLKADQSDADVFVECMSLN
SEKFSCDPSELEAYSSALNDVLEQQLEQTVSDPLAGSIAHNTSYEPMDVDEINETMEMLK
DVLAPEDHQLLQQQFLGDVLPPGMGQELYHRQQQSPQEGTQVPLEREQSQPQSMPVQEVP
QLEKKVPEAEQSVGQCQKQDVPLPAIGLFQENGSPQEQAEQQLPAVYPSQEQKQLSKELE
VALPAAVEPPQEPNQSTQEKTAQSQTCQGAEQLVKALTMDQMLQEEPQEKIQNSEICQLH
EQQVIVHPQEVQLEKQEPKECPVLMNSSHISMENEHEQSLQLEQPQEPEIETEQVVPSPA
EEHLKKPEEPAVAPLSPPIPTLQANRVEYPISPPIPTHRPKTAEELMFLALKEFPLSANE
GDLGSDDKATVPEEKKPDQGTVVAVTPSQLQQTIKPHHQELDSSSSNPKVLSTGPNSPSF
PIKGPTEQSAHFPRSPHAPAERKEMSYLEEAVIDSTAQRKLSICEPGVIAKSPVTIKVSQ
PSPEQRHLNETLPMGEVSPEPQDVTFDSGKRIEHSPQNEDTAFQDLSTFAVSLGAADDHQ
RRTFSVIKSTEDQQEAGESKSRRTFSLEKDKPRRTFCVEAHASPAVEATEESMGSEDYEA
MDVDVSVQVQEATTLKSPRTPAQVPSSPPIPTHQNLTRPPIHVEYAPAASRQGNAPAVVE
EQALSAKEQAHLSARDEKDVFVEYFGALSPVSEDMFKTPQYTSSGFNNLAKMKSGLGGGA
PTMSLPGKRQEEEQFSEDEFQDAASNTKLILNSSDFDYLYTKGNNNAPVDRSSLLLKFDP
LLGAAVPVNRIKKHAKMSVDVIDNDCNKAFDNCNLNTEDKSHTYNNMDELEKKIKNEVTL
SEDIEKKLKDAEQREEALIKRITEKDKINSKLTGVIETYEKVIAELISEKEQLRQNYETQ
LQEVQTSRDANYHHLTSLETTFFDLHVKYEKSKEMTSELKNSEDTLLKEKKQLMENVRLQ
EQRYEKMRSHAMQQLEIANKKLDTNAREHADEVKKLKALLKKEEVSRVSTAEHLQQKSRE
NADLLKICEELIYGKGQGGSS
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggatttcatcacgagcatgatcaaacggcccctgagcattcgcctaacagacgccaac
agcagcagcagtggcagcggcctttcgtcggcggattccaatccaaaggattccccatct
gcattggctagcatggctgtccacccggtcgtggccacagaggatttgcttcaactgggg
gatctggaaccgctgcccagcgctagggagagcattcaaaagctcctgcttgacgtcaat
gtgaatctgagccaagttagcgcccacgaaatggaacatttgcaggccatgagtgcggag
atgagtccgctggcagtgaagcagagtgtcaggccgagtttggagaaacaaaaggctctg
gctacggcaatgatcataccgccatcagaggacctggcgattgagccagtggctcctaga
tttgggatgttcgatgaggagcagataccggagctcgctccactcagtgccgaaatggag
gcccaactgaaagccgatcaatcggatgcggatgtctttgtggagtgcatgtccctcaac
agcgaaaagttctcctgtgatccttcagagctggaggcctattcgagtgccctcaacgat
gtactggagcagcagctggagcaaacagtcagtgatccactggctggcagtattgcacac
aacaccagctacgagcccatggatgtggacgaaattaacgaaaccatggaaatgctaaag
gatgttttggctccagaggatcatcagttgctgcagcagcaattcctcggggatgtcttg
ccgcccggtatgggtcaagagctgtaccataggcaacagcagtcgccgcaggagggaaca
caggtgcccctggaaagggagcagtcacagccacagtcaatgcctgtgcaggaagttcca
cagctggaaaagaaagtgccagaggcagagcaatccgttgggcagtgccagaagcaagac
gtgcccttgccagcaattggtcttttccaggagaatgggtcgcctcaggagcaagcggag
cagcaattgccagcagtttatccttcccaagagcaaaagcaattatctaaggaactggaa
gtggctctgccagcagcagttgagcctcctcaagagccgaaccaatcgactcaggagaag
acagcgcagtcgcagacatgccagggggcggaacagcttgtgaaagctcttacgatggat
caaatgcttcaggaggagccacaagaaaagatacagaactcagagatatgccaactgcac
gaacagcaggtcatagtacatcctcaggaggtacaattggaaaagcaggaaccaaaggaa
tgtcctgtgttgatgaacagcagccatatttccatggaaaacgagcacgagcagagtctt
cagctggaacagcctcaagagccggaaatagaaacagagcaagttgttccatccccagca
gaggaacacttgaagaaaccagaagagccagctgtagctccgctctccccgcctattccg
actctgcaggcgaacagggtggagtatcccatatccccgcccatacccacacatcgacca
aagactgccgaggaactgatgttcctggcgctcaaagagttccccttaagtgctaatgaa
ggtgatctaggatcagatgataaggcaactgtcccagaagaaaaaaaacccgatcagggg
actgtggtggccgttacacctagccagttgcaacaaaccatcaagccccaccaccaagag
ctggacagcagctcctccaaccccaaggtactctcgacaggacccaattcaccaagtttt
cccattaaaggtccgactgagcagtctgcgcactttccccgctcgccgcacgctccggcc
gagcgaaaggagatgtcctacctggaggaggccgtcatagattccacggcgcagcgcaag
ctgagcatttgcgagccgggagtcattgccaagtcgccggttaccataaaagtgtcgcag
ccgagtccggagcagcgtcatctgaatgagacgctgcccatgggtgaagtttccccggag
ccgcaggatgtaaccttcgatagcggaaaacggatcgaacacagtcctcaaaatgaagat
acagcgtttcaagatttgtccacgtttgccgtgtccctgggagcagccgatgatcatcag
cgtcgcacattctccgtgatcaagtccacagaggaccagcaggaggcaggagagagcaaa
tcgcgtcgtactttctccctggagaaggacaaaccccgacgcactttctgtgtggaggcg
catgcctcgccggcagtggaggccaccgaagagagcatgggcagcgaggattacgaggcc
atggacgtggacgtctctgtgcaggttcaagaggccactacgctcaagtccccgcggacc
ccggcccaagttcccagctcgccaccaatccccacccatcaaaacctcacccgtccgcct
atccatgtggagtatgctccggcggcctctcgccaaggcaatgcacccgctgtcgtcgag
gagcaggccctgtccgccaaggagcaggcccatctcagtgcccgcgacgaaaaggatgtg
tttgtggagtacttcggggccttgtcgccagtgtcggaagacatgttcaagacgccacag
tacaccagtagtgggtttaataatttagccaaaatgaagtccggattaggaggaggagct
cccacaatgtccctacctggaaagaggcaggaggaggaacagttttccgaagacgagttt
caggatgccgccagtaatacaaaattaatactcaactcttcagatttcgattatttgtac
accaaaggcaacaataatgccccagtggatcggagctcgttgctattaaagtttgatccg
ctgctcggagctgcagtgccagtgaataggataaaaaagcatgctaaaatgagtgtggac
gttatagacaacgattgcaacaaagccttcgataattgcaaccttaatacggaggacaaa
tcccacacctacaacaatatggacgaactggagaagaagatcaaaaatgaagtaaccctc
tcagaggacattgagaagaagctgaaagatgcagagcagcgtgaagaggcgctcattaag
cgcattacagaaaaagataaaataaattcaaagctcactggcgtcatcgagacctatgag
aaagtcattgcggagctcatcagcgagaaagagcagctgagacagaactacgaaacacaa
ctgcaggaagtgcaaacaagtcgcgatgcaaattaccatcacttaacgtcgctggaaacg
acgttcttcgatctgcatgtgaaatatgaaaagagcaaagagatgacatcggagctgaaa
aacagcgaggatacgctgctgaaggaaaaaaaacagctgatggagaatgtgcgattgcaa
gagcagcgctacgagaagatgagaagccatgccatgcagcagctggaaattgccaataaa
aagctggacacaaacgcaagggagcatgcggatgaggtgaaaaaactaaaagctttactc
aaaaaggaggaagtgtcgcgagtctcgacggccgagcacctgcagcagaagtcgcgcgag
aatgccgatctgctgaagatctgcgaggagctcatctacggcaagggccaaggtggtagt
agttaa

DBGET integrated database retrieval system