KEGG   Drosophila persimilis: Dper_GL21521Help
Entry
Dper_GL21521      CDS       T01063                                 

Definition
GL21521 gene product from transcript GL21521-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dper_GL21521
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dper_GL21521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 648 aa AA seqDB search
MTTPVPRRIKDLLALGIDSDTDDDYNTPLKPHRSNIAAVKNPRPAAAASAFGQRSVIGFN
NAGNKENIPLHNRAAGEVLPRRVSEMAMMDSDSDEEDDNKNDHNLNCAILNDSFVLSPTH
ELSVSGGPASSTGAALKQSDSNLSFLGRFGNMGINCSSSTTAPNQNSPAAAPEPQAIKKL
QTISERRKLFDDETPLRNGSSIVAKSHAKPEGDFITPLVRVRGSTQASKPRSAVSNEFRS
QKVLFQTPMTVGRGAPFPCDSFSLCDTISESPDIPPAKPEPQPKAEHIHGKSKKSLDNAF
HEAENEMLPPKIEPVKPKDVVSVPIKKPEPLPPSTSTKSSNNIIKIKDHEYAICQKLGCG
GSSSVYLARRPDSGGEFALKVVDLQADPTVVQGYLNETKLLEKLQGNVCVVALYDYQLLR
EESKLYVVMEKGDSDLNKILQSYTTNLPAYSLMSILYQMLQAVNYIHLHGVIHSDLKPAN
FLMVNGRLKLIDFGIASNISVDSTSIIKFSQAGTFNYISPEALTDISTGNSPMRGANQPK
IKISTKSDVWSLGCILYLLLYQKTPFGHIRNICAKMNAIANPGTNIEYPEIPFYYPAMLV
HMVKNCLQLNPKMRPSCTQLLQYPFHMVIPLQNLQIGSKASTNQPTTK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgactactcctgtgccgcgccgcatcaaggacttgctagcgcttggtattgactcggac
acggacgatgactacaatacgcctctcaagccgcaccgatcaaatatcgcagccgtaaaa
aacccacggccagcggcggcggcatctgcattcggtcagagatcagtcatcggcttcaat
aatgctggcaataaggaaaacattccacttcacaatagggcagccggtgaagtgctgcca
cggcgcgtctctgaaatggccatgatggactcggacagcgatgaggaggatgataacaaa
aacgaccacaatctcaactgcgccattctcaatgattcctttgtgttgagtcccacgcac
gagttgtcggttagcggtggtccagcttcctccacgggggccgcactcaagcaatctgat
tcgaatttgtcattcctgggacgcttcggcaacatgggcatcaactgcagcagcagcacc
actgcccccaatcagaactccccggcggctgcgccagaaccgcaggccatcaaaaagctc
caaacaatctcagagcgacgtaaactatttgatgacgagactcccctgcgcaatggatcc
tcgattgtggccaagtctcatgcgaagcccgaaggtgacttcataacgccactggtgcga
gtacgcggctccactcaggcatctaaaccccgcagtgcggtatccaatgagtttcgctcg
cagaaggttctcttccagacgcccatgaccgtgggccgtggcgctccctttccctgcgac
agcttctccctgtgcgacaccatcagtgagagtcccgacattcccccggcaaagccagag
ccgcagcccaaggcagagcacatccatggaaagtcaaagaagtctttagacaatgctttc
catgaggcagaaaatgaaatgttgccgccaaaaattgagccagtgaaacccaaagatgtt
gtgtcggtgcccattaagaaaccagagccattgccgccctccacctccaccaaatcatcg
aacaacataataaagataaaggatcatgagtacgcgatatgccagaagctgggctgtggc
ggctccagttccgtttacctggcccgtcgtccggactctggtggggagtttgccttgaag
gtagtggatctgcaggccgatccgacggtggtgcaaggctatttgaatgaaaccaagctg
ctggagaagctgcagggcaacgtatgcgttgtggctttgtacgattatcaacttctgcgc
gaggagtccaagctgtatgtggtgatggagaagggtgactccgacttgaacaagatcctc
caaagctacaccacaaatctgcccgcctacagcctgatgagcattctgtaccagatgctg
caggctgtcaactatatccatttgcacggtgtcatacactcggacctgaagccggccaac
tttctgatggtcaatggccgtctgaagctgattgactttggaattgccagcaacatttcg
gtggactccaccagcatcataaagttctcccaggcgggcacctttaactacatcagtcct
gaggcgctcacggatatctcgacgggcaacagtcccatgcgcggtgctaatcagcccaag
ataaagatctccaccaagtcggatgtatggtccttgggctgcatactgtatctgctgctg
taccaaaagacgccctttggtcatatacgcaatatttgtgctaagatgaatgccattgcc
aatccggggacaaacattgagtatccagagatacctttctactatccagccatgctggtt
catatggtcaaaaattgccttcagctgaatcccaagatgcggccctcgtgcactcaactg
ctgcagtatcccttccacatggtcattcccctgcagaatctacagattggcagcaaagcc
agcaccaaccagccaacaactaagtag

DBGET integrated database retrieval system