KEGG   Drosophila persimilis: Dper_GL21564Help
Entry
Dper_GL21564      CDS       T01063                                 

Definition
GL21564 gene product from transcript GL21564-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dper_GL21564
   01230 Biosynthesis of amino acids
    Dper_GL21564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL21564
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dper_GL21564
Enzymes [BR:dpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dper_GL21564
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dper_GL21564
  Exosomal proteins of melanoma cells
   Dper_GL21564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 309 aa AA seqDB search
MLALARKPLESHVFIELMKLCPIFSCSYSNSNSYAYSHSHSHSKSYSKDSCQEKKKGLYK
VVMVRHGESEWNQKNLFCGWFDARLSEKGLQEACSAGVALKKAKMEFDVAYTSLLTRAQE
TLAAALSASGHKTIPICKTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPP
MEKDHKYYDIIVNDSRYCDQLDPKDFPKSESLKLTIERCLPYWNDVIVPQIQEGKRVLVA
AHGNSLRGVVKHLEGISDEAIMGLNLPTGIPFVYELDESLKPLGTLKFLGDPETVKKAME
AVANQGKAK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttggctcttgctagaaaaccattggaaagtcacgttttcattgaactgatgaaactt
tgtcccatatttagttgctcctactcgaactcgaactcctacgcctactcccactcccac
tcccactccaagtcatactcgaaggattcatgccaggagaagaagaagggcctgtacaag
gtcgtgatggtgcggcatggcgagtccgagtggaaccagaaaaatcttttctgcggctgg
ttcgatgccaggctgagcgagaagggtctgcaggaggcctgttcggcaggagtagcactc
aagaaggccaagatggaattcgatgtggcctacacctcgctgttgacgcgggcacaggaa
accctggcggctgcactatcggccagtggtcataagacgattcctatctgcaagacttgg
cgcctgaacgagcgacactatggcggcctgacgggcctcaacaaggcagagacagcgaaa
aagtttggcgaggagaaggtgaagatctggcggcgcagcttcgacaccccgccgcctcca
atggagaaggatcacaagtactatgacatcattgtgaacgattcgcgctattgcgatcaa
ctggatcccaaggattttccaaagtctgagtccctcaagctgacaatcgagcgctgtctt
ccgtactggaacgacgtgatagtaccccagatccaggagggaaagcgagtcttggtagcc
gctcatgggaacagtctgcgaggtgtggtgaagcacctggagggcatatctgatgaagcc
atcatgggcctcaatctgcccacgggaataccctttgtctacgagctggatgagtctttg
aagcctttaggcactctgaagttcctcggtgatcccgagacggtgaagaaggccatggag
gctgtggccaaccagggcaaggccaaatag

DBGET integrated database retrieval system