KEGG   Drosophila persimilis: Dper_GL21689Help
Entry
Dper_GL21689      CDS       T01063                                 

Definition
GL21689 gene product from transcript GL21689-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dpe  Drosophila persimilis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dper_GL21689
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dper_GL21689
Glycosyltransferases [BR:dpe01003]
 Polysaccharide
  Storage polysaccharide
   Dper_GL21689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 771 aa AA seqDB search
MMQRAGLAACDADDQDSSMNMSMGTGTDTEAIRRRVRSAACNLRSEQISFELNSAEQHIN
SMMRRQMSYRFEDQDASPYGLRMNRRFSRVESGVDLKDYFDRGDIASRENRWNFEVAWEV
ANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEVCARTEMEEMEFPRGNPLLDAVNSLR
SRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILG
FMIAEFLEEFRNFAVTYSQNHDLNPPRVVAHFHEWQAGVALIVLRTRQVEIATVFTTHAT
LLGRYLCAGNTDFYNNMDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAE
HLLKRKPDIITPNGLNVKKFSAIHEFQNMHAVAKEKINEFVRGHFYGHMDFDLDKTLYFF
IAGRYEFGNKGADIFIEALARVNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIK
QLRDTINNVQQAVGKRMFDTCVKGRLPEVGDLLEKDDMVKIKRCMYAMQRESMPPVTTHN
VADDWNDPVLASIRRCHLFNSVNDRVKMVFHPEFLNSSNPLFGIDYEEFVRGCHLGVFPS
YYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLEDSIQQL
SSFMMDFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLY
GSRSNLVFSRPHSEPPSPTSSRHTTPAPSVHGSEDEDSVDEETELKELGIK
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaacgggccggcctggcggcgtgtgatgccgatgaccaggacagcagcatgaac
atgagcatgggaacgggcacagacacagaagcgataaggcgtcgcgtccgaagcgcagct
tgtaatctacggtcagaacagattagcttcgaactgaactcagccgaacagcatatcaat
agcatgatgcgacgacaaatgtcctatcggtttgaagatcaagacgcctccccatatggc
ttaaggatgaatcgacgcttttcgagagtggagtccggcgtggacctgaaggattacttc
gatcgcggcgatattgcatcgcgcgagaaccgctggaactttgaggtggcatgggaggtg
gccaacaaggtgggcggcatttacacagtcatcaggtccaaagcctacgtgtccaccgaa
gagatgggcgaacagctgtgcatgatgggaccctacaaggaggtctgtgcccgcaccgag
atggaagagatggagtttccgcgtggcaatcctctgctcgatgccgtcaattcgctgcga
tctcgcggctacaagatccacaccggacgctggctggtggacggcaatccccagctcatt
ctgtttgacattggctctgcagcctggaagctcgaccagttcaagtcggagatgtgggag
aagtgccacattggaatacctcatttggatatcgagactaacgatgccatcatcctgggc
ttcatgatcgccgagttccttgaagagttccgcaactttgctgtcacatactcacaaaac
catgaccttaatccgccccgggttgttgcccacttccatgagtggcaggccggcgtggcc
ctgattgtgctgcgcacacgacaggtggaaattgccaccgtcttcaccacccatgccact
ctgctgggtcgctatttgtgtgcgggcaatacggacttttacaacaacatggataagttc
gctgtggacgaggaggcgggcaagaggcagatctaccatcgatactgcttggagcggggc
gccacgcacctggcgcatgtgtttacaaccgtctcggaaattactggctacgaagccgag
catctgctcaagcgcaagccggacattatcacgcccaacggccttaacgtgaagaagttc
tcggccattcacgagttccagaacatgcacgccgtggccaaggagaagatcaatgaattc
gtgcggggtcatttctatggccatatggactttgatttggacaagacgttgtatttcttc
atcgctggtcgctacgagttcggcaacaagggcgccgacatcttcattgaggccctggcg
cgtgtgaacgccatgctgaagcacgagcgccccgacaccacggtggtggcgttcctcatt
ttccccaccaagacgaacaactttaatgtagactcgctgcgtggccatgcggtgatcaag
cagctccgtgacaccatcaacaacgtgcagcaggcggttggtaagcgcatgttcgataca
tgcgtcaagggccgcctacccgaagtaggcgatctgctggagaaggatgatatggtgaaa
atcaagcgttgcatgtacgccatgcagcgcgaatcgatgccgccggtgactacgcacaat
gtggccgatgactggaacgatccggtgctggcgtcgattcgtcgctgtcatctcttcaat
tcggtgaacgatcgagttaagatggtcttccatccagagttcctaaactcgtctaatccc
ttgtttggcatcgactacgaggagtttgtccgcggctgccatctgggcgtcttcccctcc
tactatgagccctggggatacacacccgccgagtgcactgtcatgggaatacccagtgtg
accacgaatctgtctggcttcggctgcttcatgcaggagcacatcagtgatcccaagtcg
tatggcatctacatcgtcgatcgtcgctacattggcctcgaggacagtatccagcagttg
tccagctttatgatggacttctcgcgtctgaatcgccgccagcgtatcattcaacgcaat
cgtactgagcgtctcagcgatttgctcgactggcgtaccctgggcatttactacagacag
gccagggtcaaggccttgcaggccgtctatccggactatgtggatgagttaagcctatac
gggtcccgcagtaacctggtcttctcgcgcccccacagtgaaccgcctagccccacctca
tcgcgtcacactaccccggccccatctgtacatggctcagaagatgaggactccgtggac
gaagagaccgaactcaaggaattgggcatcaagtaa

DBGET integrated database retrieval system