KEGG   Drosophila persimilis: Dper_GL21921Help
Entry
Dper_GL21921      CDS       T01063                                 

Definition
GL21921 gene product from transcript GL21921-RA
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL21921
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dper_GL21921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 232 aa AA seqDB search
MAQSRMVVNDDYEHPDYLEYILESVLMPSDESLDFNLLRNDYNSVLLHKCQCDKGGCANN
ERCLHGGAYEYCPDGKELIQRQTNEKGNIPIVECNSFCECRIDFCTNRLVQYGPRANLEV
FNSPTYKSKGVRTKVSIPCGAFICEYAGEILTISEAKRRIVTNKKLGSMNYVLILNEYTK
TDDCYKDKRQVTIIDPSRRGNIGRYINHSCDPNCQITAVRIDCPIPKICEFY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatctcgaatggtagtgaatgacgactatgaacacccagattatctagaatat
attctagaatccgttctgatgcccagtgatgaaagcttagatttcaatctgttaaggaac
gattacaactctgtgcttttacacaaatgtcaatgcgataaaggcggttgtgcaaataac
gaaagatgcttacacggaggtgcttatgagtactgtccagatggaaaagaattgattcaa
aggcagactaacgaaaaaggcaatatcccaattgtggagtgcaattccttctgtgagtgt
cggatagatttttgcactaatcgacttgtgcagtacggtccaagagcaaatttggaagta
tttaattctccgacttacaaatcaaaaggtgtccgcacgaaagtaagcattccttgtggt
gccttcatctgcgaatatgcaggggaaattctaactatttctgaggccaaacgacgcata
gttaccaacaaaaaactgggatcaatgaattatgtgttaatactcaacgaatacactaag
accgatgactgctataaagataaacgacaagtcaccattatagatccttctcgacgtgga
aatattggacgctatattaaccacagctgtgaccccaattgtcagataacagcggtacga
atagattgtcccataccaaaaatatgtgagttttattaa

DBGET integrated database retrieval system