KEGG   Drosophila persimilis: Dper_GL21944Help
Entry
Dper_GL21944      CDS       T01063                                 

Definition
GL21944 gene product from transcript GL21944-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL21944
   00053 Ascorbate and aldarate metabolism
    Dper_GL21944
   00500 Starch and sucrose metabolism
    Dper_GL21944
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL21944
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL21944
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL21944
   00982 Drug metabolism - cytochrome P450
    Dper_GL21944
   00983 Drug metabolism - other enzymes
    Dper_GL21944
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL21944
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL21944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 646 aa AA seqDB search
MRLLQLLMALSLLCGAISCANILAVLPSVWKSHYLFGRRLLQELVASPRNHSITLISPHA
LEAGGVDAELPNIREIRIEGLKENWVGMGMSFEPEQMRSQSVMERFTRLIYAGTTNVDLL
LSDQQVRKLLTSGEQFDLLIVDLFLSDALLGLAYYYGIPTVAISPTGANSWLNNMFGNPQ
SSSLDPSNFLPFTERMNTQQRIVNSLMSTFERLTYNFFHLISQQTVYSKHFEMLVQELPL
YRDLTKNLSLALINSHPGLNYPRAYLPNMVEVGGLHLTARTDLRPLPNHLLSFMESAAGG
CIYMSLGADVQTAQLPSEKLAIFMDVFGHLKEFHFVLKWENEDFVSSLELPENVMIANWW
PQQAILSHTLVKLFISSCGQLSVWESVMGETPILAIPILAEQEVMAKRLQLNGVSLTVNY
DAIAYDALLHGIRQLTLNTSYSESLVKLRKRLGGPSPSSLAVGQIELILDSGGADFLKSH
ANTLNYWRLEGLDVLVIITIGFVGILTIPFLVISCILRKSYYSEACQDQQPPYRSTLKVV
GRVHSYGEPGGTPAEPLRRTRSAQSLSARSSSSSFSSNTTPPTTASTTPLDMTPPPPAVV
QLLGHVPSPLQLYVNQQQQQQQIYSNSDLSNRQQASQDDNTERRFS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgctgcagctgttgatggccctgtcgctgctctgcggcgccatctcctgtgcc
aacatcctggccgtgctgcccagtgtctggaagtcgcactatctttttggccgacgactg
ctgcaggagctggtggccagtccgcggaatcattcgatcactctgatcagtccgcatgcc
ttggaggcgggtggagtggatgcagaactgccaaacatcagggaaatacgcattgagggg
ctcaaggagaactgggtgggtatgggcatgagctttgagccggaacagatgcggtcgcag
agtgtgatggaacgtttcacgcggctcatttatgcgggcactaccaatgtggatttgttg
ctgtcggatcagcaggtgcggaagctgctaaccagcggcgagcagtttgatctattgatt
gttgatttgtttctaagcgatgccctcttgggcctggcctactactatggcatacccacc
gttgcaatcagtcccaccggtgccaattcctggctaaacaacatgttcggcaatccccaa
tcgtcgtccctggatccaagcaactttctacccttcacagagcgcatgaatacccaacag
cggatcgtcaatagcctcatgagcactttcgagcgtctaacctacaacttctttcatttg
atctcccagcagacggtctactcgaaacactttgagatgctggtgcaggaactgccgctg
tatcgggatctaacgaagaatctcagtttggctctgataaactctcatccgggcctaaac
tatccgcgtgcctatttgcccaatatggtggaggtgggtggcctccacttgacggctcgc
acggacctacgcccattgccgaaccatctcctgtcgtttatggagtctgctgcggggggt
tgcatctacatgagtctcggtgccgatgtccagacagcgcagttgcccagcgaaaagttg
gccatattcatggatgttttcggtcacctcaaggagttccatttcgtgctaaagtgggaa
aacgaggattttgtatcgagtctggagctgccggagaatgtgatgattgccaattggtgg
ccccagcaggcgatattgtcgcacacgctggtcaagctgttcatcagcagctgcggccag
ttgagcgtatgggaatccgttatgggcgagacgcccattctggccatacccatactggcc
gaacaggaggtgatggccaagcgtctgcagctgaatggagtctcgctgacggtcaactac
gatgccatagcctatgatgccctgctgcacggcatccggcaactaacactgaacaccagc
tattcggaaagtttagtcaaactaaggaaacgtcttggtggtccctcgccatcctctctg
gccgttggccaaattgagctcattctggactcgggtggcgcggatttcctcaagtcccat
gcaaatactcttaattactggcgtctggagggcctggatgtgctcgtgatcattacaatc
ggctttgttggtattctgactattccgtttttggttatttcttgcatcctacgcaagtcg
tactacagcgaagcgtgccaggatcagcagccgccctatcgttccaccctgaaagtagtg
ggcagggttcatagctatggcgaaccaggaggcactccagcagagcccctgagacgcact
cgctcggcccagtccctttcggcacgctccagctcgtccagcttcagctccaacacgaca
ccgccaacaacagcatcgaccacaccgttggatatgacaccaccaccgccagcggtggtg
caactcctggggcatgtaccatcgccgttgcagctgtatgttaatcaacagcagcaacag
cagcagatatactcaaactccgatttgagcaatcgacaacaagcatcacaagatgacaac
acagaacgaaggttttcatag

DBGET integrated database retrieval system