KEGG   Drosophila persimilis: Dper_GL22116Help
Entry
Dper_GL22116      CDS       T01063                                 

Definition
GL22116 gene product from transcript GL22116-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL22116
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1345 aa AA seqDB search
MNHQARLSLSIMSPHHSNPIADSTRIDGSPVAHRHSPANLIHRTMSLERSQSTTNGTPGN
RTASSTTTMSRQKLNLSLMDPKTFADVHSSGLASRIVAYHNDSTLGGRRGLQRSISVSNL
YNPLKQPRRTPSSPLPYRPSPPSLSMTRIAPPERSFYCGSTLPGLLRSNSVVGVHKVSNN
EHEQLSRENRPILHPHPPQHESEPTRSVLEELKEISRKRINSGDTQKQHEFFKRSCHRIG
DFVDHHHHPPPATTFKRQRELSVAVPLRHHHAATMVPPLAPPTQTQHHLQPTEAVSPEQL
AKRRNCSYNNDIASSLSSSRRHVTKRKLYDMRESMRQTSMEGTANGSSPENSPSAPVSKM
QRKTDAEPIAIAKSMPIVGVPVVAPSRTISAPAMGQQHQINTELHRNTAVDLPLAASKPK
LTLFNTKQTQQQVQEQTKHYDLESPDVDAGEYAGINFVKPKQQNSLSGVKNPSVERTHKT
KLAIMLSGLRGEIYQGEEEEPDEMDAPVSPKTPIKPIVLTTTKAVSPNTTTKVSLSTITK
TTTTSSSDKPIILSDKVIAPAPGTGTATATATTTMTNGLQPKLLFGQAPTPATSAAAEAA
SPNESSKETPTAVNTAPTTSSSPAATPVLTFGSQKSTATVIGAPLKTTSVFAPTSSAQAP
VLSFGKAPPVDTAIPFKLENNPTNKMNGIPTNGIATTSASTPAATASPAAMTFGSSTTNN
ATSTAAFMFGKTEESSAPAAAKPPVFSFGGSTASAPTPTQTPTPTATATPSPATGTSLFG
NPQPHNNSFGSAFKQPEANKAATTVPEPAKPSAIIGVKPNFGGNSFGSAFKQPAATVTAT
ATTTAAEPTKAFSFTGTTNTAAATTSNLFAFGSAAVAKPAEPAPAPAPAPAPAPAPTSGN
IFGQSATASTPALFSFGGAAAASAAAAAPNTIKETKPAFAFGGDASATTAVQSNGSNSSG
SNNLFNFGAGVTSGAPPSFGGATSTNAPSKSAFSFSTAQKPTSQIGNNAAPTASKPFAFG
GGQPQVPGTTASTAGSAASPGGFSFVAAAGKKEAATSGASLFGTPNNASTGVKPSFSFGG
SSNNQGAATSTPPAGQQQQQSAPGQPGAFSFAAVAKKETSGASIFGQPAAAAAAAATPSA
SIKPSFSFGGSSNNTQNAPSAHVAAPSFGGFGAPAVPATSNQSKPFAFGGTTTAAPNATP
AIGGNLFANAVSAVQNQAKPGGFSFGGTTTKTNAPAPPGNAPFSFGGAAAGGMASPPSSQ
NVNTAKPFSFGGGVSAFGSPSPSPVQAAAATNPGAGAFSFGSPAPPSASVAPGMSQQINA
GNMFALPPSTSEQRPIRRATRRLQK
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcaggcgcgcttaagtttgagcatcatgtcaccgcatcacagcaatccgatt
gctgactctaccagaattgatgggagtccagtagctcatcggcattcgccggcgaatctc
atacacagaactatgagtctcgaacggagccaaagcacaactaatggcaccccggggaac
cgcaccgcatcatcgacaacaacaatgtcgcgacagaaactgaacctcagtctgatggat
cccaaaacatttgcggatgtgcacagcagtggactggcctctcggattgttgcatatcat
aacgacagcaccttgggcggccgtcgtggcctgcagcgcagcatatctgtgagcaatctg
tacaatccactgaagcagccaagaaggaccccgtcgtccccactgccgtacagaccatcg
ccaccgtcactgtccatgactcgaatcgcgccgccagagcgcagtttctactgcggcagc
acgctgcccggcctgctgcgttccaattcggtggtgggtgtccacaaggtgtccaataat
gaacacgaacagttatcacgggaaaatcgccccatcctgcatccacatccgccgcagcat
gagagcgagcccaccaggagtgttttggaagaactcaaagagatctcccggaagcgtatc
aacagtggggacacacaaaagcagcacgagtttttcaagaggagctgccatcgcattggc
gactttgtggaccatcatcaccatccgcctcccgcgacaactttcaaaaggcaacgagag
ctgagcgtggcagttccactgagacaccatcatgcggcgacaatggtgccaccgctggcg
ccgccgacacaaacgcagcatcacctgcagcccactgaggccgtttcaccggagcagctg
gcaaagcggcgcaattgtagctacaacaatgacatcgcctcctcgttgagttccagccgg
cggcacgtgaccaagcgcaagctgtacgacatgagggaaagcatgcggcagacgagcatg
gagggcacagccaacggcagctcgcccgagaactcccccagcgcaccagtgtccaagatg
cagcgcaagacagacgcagaacccatagccatagcaaagagtatgccgattgtaggagta
ccagtagtggcgccctcacgcaccatctcagcgccggctatgggacagcagcaccagata
aatacagaactacacaggaacaccgcagtggatctgccattggctgcctccaaaccgaaa
ctcacgcttttcaataccaagcaaacacaacagcaggtgcaagagcagaccaaacattac
gatcttgagagtcccgacgtggatgctggcgaatacgcgggcataaattttgtgaagccc
aagcagcagaactccttgagtggcgtcaagaatcccagcgtcgagcgcacacataaaacg
aagctggccattatgctgagtggcctgcgcggcgagatctaccagggagaagaagaagaa
ccagacgaaatggacgcccctgtcagtccaaagacacccatcaaaccgattgttctgacg
acaaccaaagcggtatcacccaacacaacgaccaaagtcagcctctcgacaataaccaag
accacgacaacgtccagcagtgacaagccaattatattgagtgacaaggtgatcgcacca
gctccaggaacaggaacagcaacagccacagctaccacgactatgacaaatggtttgcag
ccgaagcttctctttggccaagcaccaacaccagcgacatcagcagcggcagaagcggca
tcacccaacgagtcatccaaagaaacgccaactgctgtcaacacagccccaacaacatcg
agctcacctgcagccacaccagtactgacattcggaagtcaaaaatccactgccacggtt
atcggggcccctttgaaaacaacatcagtctttgcccccacaagcagtgctcaagcgccc
gtactgtcatttggcaaagcgccgccagtagacactgcaataccattcaaactggaaaac
aatcccacaaacaagatgaatggaataccaaccaatgggatagcaactacatcggcgtct
acacctgcagcgactgctagcccagcagcaatgaccttcggaagcagcaccacaaacaat
gcgacaagcacagccgcgtttatgtttggaaaaacagaggagtccagcgcaccagcagca
gccaagcctcctgtctttagttttgggggcagtacagcgtctgcaccaacaccaacacaa
acaccaacaccaacagcaacagcaacaccatctccagcaacaggaacatctttgtttggg
aacccacagccacataacaacagctttggcagcgcatttaagcagcccgaagcgaacaaa
gccgccacaacagttccagagccagcaaagccgtcagccataatcggagttaagccgaac
ttcggtggcaacagttttggcagcgcattcaagcagcccgcagccacagtcacagccaca
gccacaaccacagctgcggagccaacaaaggcattcagtttcacgggaacaacgaacaca
gcggctgcgaccacatcaaacctctttgcatttggaagtgcagcagtcgcaaagccagca
gaaccggcaccggcaccggcaccagcaccagcaccagcgccagcgcccacctcaggtaac
atctttgggcagagtgcaactgccagtacacccgcactgttttcttttggtggtgctgca
gcagcatcagcagcagcagcagcaccaaacaccatcaaggaaacaaagccagcatttgca
ttcggaggcgatgccagcgcgacaacagctgtgcaatccaatggcagcaacagcagcggc
agcaacaatttgttcaacttcggtgcaggcgtcacgagtggagcccctccttcctttggc
ggcgccacatcgaccaatgccccatcaaaaagtgccttcagcttcagtacagctcagaag
ccgacctctcagatcggcaataatgcagctccaacagcctcaaaaccatttgcatttggt
ggcggacagccacaggtccctggaacaaccgcatccaccgctggctcagctgcatcgccc
ggaggattctcctttgtggccgctgcagggaagaaggaggcagcaaccagtggagcgagt
ctttttggaacaccgaacaacgccagcacaggcgttaagccgagctttagtttcggtgga
agcagcaacaatcagggtgcggcaacctcaacccccccagcagggcagcagcagcagcag
tcggccccgggtcagccgggagcattctcctttgccgctgtcgccaagaaggagaccagt
ggcgccagcatttttggccagcccgccgccgccgccgccgccgccgccacccccagcgcg
tccatcaagccgagcttcagttttggtggcagcagcaacaacactcaaaatgcaccatca
gcacatgttgcggcgccaagctttggcggatttggggcacctgccgtgcccgctactagc
aatcaaagcaaaccctttgcatttggtggcaccacaaccgcggcgcccaatgccactcct
gccataggcggcaacttgtttgccaatgcggtgagcgccgtgcagaaccaggccaagccg
ggaggtttctcgtttggcggaacaacaaccaagaccaacgccccggcaccaccgggcaac
gctccattctcgttcggaggagcggcagctggcggcatggcctctccgcccagcagccag
aacgttaacacggcgaagccgttcagctttggcggcggtgtcagtgctttcggaagcccc
agtccgtcaccggttcaggctgcagcagccaccaatccaggagcaggggccttcagtttc
ggtagccccgccccaccatcggcgagtgtggcgcccggcatgtctcagcaaatcaatgcc
ggcaatatgttcgccctgccgccgagcacttcggagcaacgccccatccgacgagccacc
aggcggctgcagaagtag

DBGET integrated database retrieval system