KEGG   Drosophila persimilis: Dper_GL22157Help
Entry
Dper_GL22157      CDS       T01063                                 

Definition
GL22157 gene product from transcript GL22157-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dper_GL22157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 226 aa AA seqDB search
MAWRSVGASNQDLIRQLKEYGVIGSDAVAKAMIDTDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDHLKPGAHVLDVGSGSGYLTACFYRYIKAMGEIADTCIVGIEHQASL
VAMSKANLNSDDRSMLDSGTLKIVQGDGRKGYPAHAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPEGGSQYMQQYDKDKNGKVEMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgttctgttggtgctagcaatcaggatcttatacgccaattgaaagagtac
ggcgtcattggatccgacgcagtggcaaaggcaatgattgatacggatcgaaaacactat
tccccacgcaacccctacatggatgcgcctcaaccaattgggggcggagtgactattagc
gcaccacatatgcacgcctttgcattggaatatttgcgcgatcatttgaagccaggtgct
catgtgctggacgtcggctctggttcgggttacctaaccgcctgcttctatcgctacatc
aaagcgatgggggagattgctgacacctgcattgtgggcatcgagcaccaggcctcgtta
gtggcaatgagcaaggccaatttaaattccgacgatcgtagcatgctcgactctggaacg
ctaaaaattgtgcagggcgatggacgcaaaggatacccggcacatgcgccgtacaacgcc
atacatgtgggagccgctgctcccgatacgcccaccgaactcatcaatcaactggccaac
ggaggccgcctgatagtgccagttggacccgagggcggctcgcagtacatgcagcaatac
gataaggacaaaaatggtaaagtagagatgacgcgtcttatgggggtgatgtatgttcca
ctcacggatttacgctcctga

DBGET integrated database retrieval system