KEGG   Drosophila persimilis: Dper_GL22182Help
Entry
Dper_GL22182      CDS       T01063                                 

Definition
GL22182 gene product from transcript GL22182-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dpe  Drosophila persimilis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dper_GL22182
   00670 One carbon pool by folate
    Dper_GL22182
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dper_GL22182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 185 aa AA seqDB search
MLRFNLIVAVSENFGIGLKGDLPWRLKSELKYFSRTTKRTSDPNKRNVVIMGRKTYFGVP
ASKRPLPERLNIVLSTTLQPAELPSDVVLCPSLEEAMKHLEEETLRDQIENVWIVGGSGV
YEEAMASSRCNRLYITKIQQNFECDTFFPSIPDCFREVPPDADTPVGVQEENGIKYEYKV
LEKRE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttaatctaattgtcgcggtgtccgagaacttcggcattggcttaaaggga
gatctgccatggcgcctaaaatccgagctgaagtattttagtcgcaccaccaagcgaacc
agcgatcccaacaaacgcaatgtggtaataatgggcagaaagacatattttggagtgccc
gccagcaagcgtccgctgccagagcgtttgaacattgttttgagcaccacgttgcagccc
gcagagcttcccagtgatgtggtcttgtgccccagcctagaggaagccatgaagcatctg
gaagaggagaccttgcgcgaccaaatcgagaacgtctggattgtgggcggtagtggagtt
tacgaggaagccatggcctcgtcccgttgcaaccggctgtacataaccaaaatccagcag
aatttcgagtgtgataccttctttcccagtattccagactgctttcgtgaggtgccgccc
gatgcggacacacccgtaggcgtgcaggaggagaatggcattaagtatgagtacaaggtt
ttggaaaaacgagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system