KEGG   Drosophila persimilis: Dper_GL22255Help
Entry
Dper_GL22255      CDS       T01063                                 

Definition
GL22255 gene product from transcript GL22255-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dper_GL22255
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dper_GL22255
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dper_GL22255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 416 aa AA seqDB search
MSHQSNNVLRPKANAMARKPEAVTALGMQKKNLLLTKKSTSENMAPGCKLLPSSVSAKTA
TTIARPAQDAMSKFAKPLVPTASTLKKPTSEFVAPAPVTEPKKTNADPVDKPLATATATE
AARSAESTASSSSNSTDKEKGKTENQPPKPKKTWELNNFDIGRLLGRGKFGNVYLAREKE
SQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAP
QGTLFNALQAQPSKRFDERQSATYIKSLCSALLYLHERDIIHRDIKPENLLLGHKGVLKI
ADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSK
NYDETYKKILKVEYKLPEHISKAAAHLISKLLVLTPQHRLPLDQVLVHPWILAHTK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcagtccaacaatgtgttgcgtccaaaagcaaatgccatggccagaaagccg
gaggcagtcactgcacttggcatgcagaagaaaaatttgctgctgacaaaaaagtcgaca
agcgagaatatggcaccaggctgcaagcttcttccgtcttccgtatcagccaaaacggct
acgacaattgcgcgtccagcccaagatgcaatgtcgaaatttgcgaagccacttgtaccc
actgccagtacactaaagaaaccaacctcggagtttgtggctccagctcctgtgactgaa
cccaagaagactaacgctgaccctgtggataaaccattagccacagctacagcaacagaa
gccgctcgatctgccgaatcgactgcatccagctcttcaaacagcactgacaaagagaaa
ggcaagactgaaaatcagccccctaagccaaagaaaacttgggagctgaacaacttcgac
attggccgtctactgggacgcggaaagttcggcaatgtgtacctggcacgcgagaaggag
tcccagttcgtagtggctttaaaagtcctgttcaagcgtcagattggcgaatccaatgtg
gagcatcaggtgcgccgggagatcgaaatacaatcgcatctgcggcacccgcacattctt
cgcttatacgcatactttcacgacgatgtgcgcatctacttgatcctggagtatgcccca
cagggtactctcttcaatgcgctgcaggctcagccgtcaaagcgcttcgatgaacgccag
tcggccacctacatcaagtcgctctgctcggccctcttgtatctgcacgagcgtgacata
atccatcgcgatatcaagccggagaatctcctgctgggccacaagggtgtgctgaagata
gccgattttgggtggtcagttcacgaacccaattccatgcgcatgacgttgtgcggcact
gtggactatctgccaccggaaatggtgcagggaaagccgcacacaaagaacgtggacctg
tggagcctgggtgtgctctgcttcgaactgctggtgggtcatgccccattctattcgaaa
aactatgacgagacctacaagaagatcctcaaagtggagtacaaactgccagagcatatt
tccaaggcggccgctcacttgatttccaagctgttggtcctcactcctcagcatcgtctg
cccctggaccaggtgttggtacacccctggattctggcgcatacaaagtga

DBGET integrated database retrieval system