KEGG   Drosophila persimilis: Dper_GL22694Help
Entry
Dper_GL22694      CDS       T01063                                 

Definition
GL22694 gene product from transcript GL22694-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL22694
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL22694
Transcription machinery [BR:dpe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dper_GL22694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 799 aa AA seqDB search
MPSAATTITNNNNNSKEKRASVGSIGGGGVGGIGGSANGSSSSTTNGQRSNSPSLAEKST
APAADGSQTDLTNNNSSNGNAAKALKTAASATAVAATTAAAAAAEPYNPLKQMLVTIEHK
IRNLEKRKTKLESYRAIQTGGKELSADQASAVAKIRCGPGQSGVCPGAGQANATAIQRGR
KGAEETGTQAKVAKIRRKQRKSDKAFVPQPFSKRTKTKENSVDSTTSVISITSSSSSTHS
GSVVVAGGLNNTSSNNKRFYPGTGAGRGTAENETAAEAAADSVAAAKTTTTTKASAKSAA
GRCVATEENETVARSGRGRGVERGKDDKDEATGSESDGGAKLTKGPLNAAYLSACLRTVQ
KLAIELDVSVDAKSVASREREASGVMSETGCRHYQSYLKEHGYDTYRVIDAYFSACVNKD
ARLKKAIHCYCFECGSASIQLYACLHCIYFGCRGSHIHSHLRAKKHHVALELSHGTLYCH
ACRDFIYDSRSREYALINRKLEAKDLQKSLGWQPWIPSAKDSNLLLANPRRRLVRPNQTI
GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCASLAQCLVCEVSRLSEFYSGSR
SPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSSSGS
GTNSTSSSTSSYGQCNCIIDQIFTGMLQSDVVCQACKGVSTTFDPFWDISLDLGETTTHG
GVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHS
ALIDRKDLLVHPSSPSSSI
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggctgctaccacaattaccaacaacaacaacaatagcaaggagaagcgcgcc
tcggtcggctccatcggtggtggcggcgtgggcggaatcggtggcagcgcgaacggtagc
agctcgagcactaccaatgggcagcgcagcaatagccccagcttggccgaaaagtcgacg
gcaccggcagcggatggcagccaaaccgatttgaccaacaacaattcgagcaatggaaat
gctgccaaagcactgaagacagccgcatctgcgactgccgttgctgctacaactgctgct
gctgctgccgccgagccgtacaatcccctgaagcaaatgttggtcaccattgagcacaaa
attcggaacctggagaagcgcaagacgaaactggaatcttatcgcgccatacaaacaggc
ggcaaggaactgagcgctgaccaggcatccgctgtggccaaaatacgatgcggtcctggc
caatctggagtttgcccgggagctggccaagcaaatgcaacagcaatccaaagaggccga
aaaggagcagaagaaacaggcacgcaagcaaaagtggccaaaattcggcgaaaacagcgc
aagagtgataaagcattcgtgccgcagccgttttccaaacgaacgaaaacaaaagagaat
agtgttgatagtactacaagcgtaattagcataacaagcagcagcagcagcacccacagt
ggtagcgtcgtcgttgccggcggcctaaacaacaccagcagcaacaacaaacgattttac
ccagggacgggagcgggccggggaacggccgaaaacgaaacagcggcagaagcagcagca
gattcagtagcagcagcaaaaacaacaacaacaacaaaggcatcggcaaagtcagctgcc
ggccggtgtgtggcgacagaggaaaacgaaactgttgctagaagtgggcgtggcagaggt
gttgagagggggaaagacgacaaagacgaagcaaccggcagcgagagcgacggcggagca
aagctaacaaagggcccactgaatgcggcgtatttgtcggcctgtttgcgcacagtccaa
aagcttgctattgaacttgacgtcagcgttgacgccaagagcgtcgctagcagggagagg
gaggcgagcggtgtcatgtcggagacaggctgccggcattatcagagctacttgaaggag
cacggatatgatacataccgggtcatcgatgcttatttttctgcctgcgtgaacaaagat
gcgcgtttgaagaaggccatacactgctactgcttcgagtgcggcagcgccagcatccag
ctatacgcctgcctgcactgcatctactttggctgccggggctcacacatccacagccat
ctgcgggcaaagaaacaccatgtggccctggagctgtcccatggaacgctttactgccat
gcgtgtcgcgactttatttacgactcgcgcagccgtgagtacgcgctgatcaaccggaag
ctggaggccaaggatctgcagaagagcctggggtggcagccgtggataccttcggccaag
gactcgaacctgctgctggccaatccacgacgccggctagtgcggcccaatcagacgatc
gggctgaggggactcctcaatctgggggccacctgcttcatgaactgcattgtccaggcc
ttggtacacaccccactgctgagcgactactttatgtcggaccggcatgactgcgcaagt
ctcgcacagtgtctggtctgcgaagtgtcgcgtctctcagagttctattcgggctcccgt
tcgccgctgtcgctgcatcgcctattgcatttaatctggaaccatgccaagcacctggca
ggttacgagcagcaggatgcgcacgagttcttcattgccacgctggatgtgctgcatcgg
cattgcgtcaaggccaaggcggagcacgagagcaagagcaatagctctagctcgggtagc
ggcaccaattcaaccagctcctcgacttccagctacggacagtgcaactgcatcatcgac
cagatcttcacgggcatgctgcagagcgacgtggtgtgccaggcctgcaagggcgtgtcc
accacattcgatcccttctgggacatttcgctggacctgggcgagaccacgacgcacggt
ggtgtaacgcccaagacgttgatcgactgcctggagcggtacacgcgggccgagcatcta
ggctccgcggcgaagataaaatgctccacctgcaagtcctaccaggagtccaccaagcag
ttcagcctacggactctgcccagcgtggtctcttttcatctgaagcgctttgaacactcg
gcgctgatcgatcgcaaagatctcctcgttcatcccagttccccgtcgagttcgatatga

DBGET integrated database retrieval system