KEGG   Drosophila persimilis: Dper_GL22815Help
Entry
Dper_GL22815      CDS       T01063                                 

Definition
GL22815 gene product from transcript GL22815-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dpe  Drosophila persimilis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dper_GL22815
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dper_GL22815
Glycosyltransferases [BR:dpe01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dper_GL22815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 908 aa AA seqDB search
MYNNNNDGGGGGSANGNTMQQRRKTTTRSRSKQQQQQQCTSENVIEKNQTNGAQNERLHF
RGSSKDSALSTPLLPRSRSTTSAINSPSPLCCNGGLSILNCCRDVNCHLNAPLRGSVESS
RSRRSESRQSSLTATPTTTPKQASPSPTISERSRSCSGSRSRSCSCDGRLVDCHKHSAAA
AAASTAAPQFTVNLSIDLFSWTLFLLAFCTRFYKLATPPHIVFDELHYGKYIAHYMRNIF
FFDQHPPLGKQLIAGLVSLAGYDGNYTFSRIGAAYAPDVPIFWFRFIPALCGSLLAPAVY
RLLLEARLHRWAAALGGLLVILDNSLLTQSRFVLMESMLLLASTLGIACLLRFQRCRLGS
LQWLCNGSAAGVLLACAGAVKYIGFLALALAGYLLCRHLWQLLYDASLTNRQLWMHALSR
LLLFVGIPIAVYIGVFYVHFRTLHRAGPHDSIMTSAFQASLEGGLASITSGQPLAVVHGS
QITLRHTHGRTCWLHSHAAVYPVRYKDKRGSSHQQQVTCYSFKDVNNWWIVKRPERDDLV
VGEQPDVIQHGDVIQLVHGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELLWRVE
ILNRNSEGDSWHAIKSEIRLVHESTGAALKFSGRQLPDWGFNQHEVVADRDQVHEDAIWN
VEEHRYTKTQDQRERERQLLSAEMIPTKRTKLSFWAKLLELQTKMFWHGKHLQAHMYSSL
PHEWPLMDKGIAYWLDSQSSAQIYLLGNVLIWYTASAGILVYAALLAFYAVRRRRLCFDV
SQHEWQRFLMAGDTFFVGYMMHYLPYYFVDRTLFLHNYLPAFVFKLLLLCFVVEHLDYLL
RRHCSGRGVHLVRVYRVALLLWLLAVGSVFVKFLPLSYGARKMTIEEVRRLRWKDTWDFI
LQKNYALN
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaacaacaatgatggcggtggcggtggcagcgccaacggcaacaccatgcag
cagcgccgcaagacaacgacacgctccagatcaaagcagcagcagcagcaacaatgcacc
agcgaaaacgtaatcgaaaaaaatcaaacgaacggcgcacaaaacgaaagacttcacttt
cgcggaagcagcaaagactcggcgctgtcaacgccgctgctgccgcgcagccgttcaaca
acctcagccatcaattcaccttccccactgtgctgtaacggtggtttgtccatactcaac
tgctgccgcgatgtcaactgccacctgaatgcacctttgcgcggcagcgtggagtcgtca
cgcagtcggcgttccgagagccggcaatcgtcgctaacagcgacgccgacgacaacgcca
aagcaagcttcaccttcgcctacgatctccgaacgttcacgatcttgttctggatcccgc
tcccgttcgtgctcttgcgacggccgccttgtagattgccataaacacagcgctgcggca
gcagctgcgtctacagccgcaccgcagtttaccgttaacctgagcatcgatctcttcagt
tggactctctttctgctggcattctgcacgcgcttttataagctagcaacgccaccccac
attgtcttcgatgaactgcactacggaaagtacatcgcccactacatgcgcaacattttc
ttcttcgatcagcacccgcccctcgggaaacagctgatcgctggcctcgtcagcctagcc
ggatacgatggcaactacacattctctaggatcggggccgcgtacgcgccggacgtgccc
atcttctggttccgctttatacccgcgctgtgcggcagcctcctggcccccgccgtctac
aggctactgctggaggccaggcttcatcgctgggcagcagcactgggcggccttctcgtc
atcctggacaactctttgctgacccagtcgcggttcgtgctcatggaatcgatgctgctg
ctggccagcacgctcgggatcgcctgtctgctccgcttccagcgctgtcgcttgggcagc
ctccagtggctgtgcaatggatctgcggcaggcgtgctcctggcttgtgcgggcgccgtc
aagtatatcggcttcctggccctggctctggccgggtatctgctctgtcgccacttgtgg
caactcctgtacgacgcgagcctaacgaatcgccagctctggatgcacgccctgagtcgg
cttctgctcttcgtgggcattcccatagccgtgtatataggggtattctatgtccacttc
cggacgctgcaccgggcaggccctcatgatagcattatgaccagtgcctttcaggcgtcg
ctggagggcggcctggcctcgatcaccagtggccagccgctggctgtggtccacggctcg
cagataacgctgcgacacacccacggacgcacttgctggctgcactcccacgctgcagtc
tacccggtgcggtacaaggacaagagaggctcctcccaccagcagcaggtcacatgctac
tcattcaaagacgtgaacaactggtggatcgtgaagcggccggagcgggacgacctggtg
gtgggggaacagccagacgtcatacagcacggcgacgtcatccaactggtgcacggaatc
accagtcgggcgttaaactcgcacgacgtcgctgctccgatgacgccccagtgccaggag
gtcagctgctacattgactacgaaatcaagatggccggggagctgctgtggcgcgtggag
attctcaatcggaactctgagggcgacagctggcatgccatcaaatcggagatacgtctc
gtccacgagtcgacgggcgctgccctgaagttcagcggacggcagctgccggactggggc
ttcaaccagcacgaggtagtggccgatcgggatcaggtgcacgaagacgccatttggaat
gttgaggagcatcgctacaccaagactcaggatcagcgggaacgagagcgtcagttgctc
tccgccgagatgatacccacgaagcggacaaagctctcgttctgggccaaactcctggag
ctgcagacgaagatgttctggcacggcaagcacctgcaggcgcacatgtacagctcgctg
ccgcacgagtggccgctgatggacaagggcattgcctactggctggactcgcagtccagt
gcccagatttatctcctgggcaacgtactcatttggtacacggccagcgccgggatactg
gtatacgccgcccttctggccttctatgcggtgcgtaggagacggctctgcttcgacgtc
tcccagcacgagtggcagcgcttcctcatggctggcgacaccttcttcgtgggctatatg
atgcactatctgccgtactactttgtggaccgcactctctttctgcacaactatctgccc
gcatttgtcttcaagctgctgttgctgtgctttgtcgtggagcatctggactaccttttg
cgccgacactgctctggccgaggagtgcacctggtgcgcgtctatcgagtggcgctgctc
ctctggctgctcgccgtgggaagtgtgtttgtgaaattcttgccgctcagctacggagca
agaaagatgaccatagaggaggtcagacgcctgcgctggaaggacacctgggactttata
ttgcaaaagaactatgcgctgaactga

DBGET integrated database retrieval system