KEGG   Drosophila persimilis: Dper_GL23010Help
Entry
Dper_GL23010      CDS       T01063                                 

Definition
GL23010 gene product from transcript GL23010-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MAQIQEYQEYLLDALEVVDFKLIRDKADINNDALIFHPVMAHQIFGETETIFGYQDLHVR
VFYTAGPLHIYLGVEYGTRVNEVSAGEMNADDVVGTIAHSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKIGEYTRPSDDGSERLFEFYQCDYKVPSFLKFFARLQTFILWFVDAASYIDT
DDAQWCYFVCYEKYKNGDGQYQYATAGYTTVYEYYAYPQNKRPRISQMMILPPFQKLGLA
TQLIETIYKYYQSQKNVVDITVEDPSEDFQRLRNFVDARFCKELKSFARNEIVKGFSKEM
VREARETLKLNPRQVRKVYELLRLYYTNVNDEKEYRSYRLEVKKRLNAVYYKQIKDLKKM
ERYKMDTEMLRARLPNMKQRMEQLQEEYAVVEEGYKNTLAKLKA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatccaagaataccaggagtatttgctggacgccctcgaggtggtcgacttc
aagttgatacgcgacaaggcggacatcaacaacgatgctttgattttccaccccgttatg
gctcatcagatatttggcgagactgagacaattttcggatatcaagatctgcacgtgcgc
gtattctatacggcgggaccgttgcacatttacttgggcgtggagtatgggactcgtgtc
aacgaagtgtctgccggtgaaatgaatgcagacgatgtggtcggaaccattgcacatagt
ttgccagacggctgctacttcatcaacctagacgagtttctgaagacgctggacaaggca
gacaagttccagcccttcggcgagaagatcggcgagtacacacggccctctgatgacggc
agtgagaggctattcgagttctatcagtgcgactacaaagttccatctttcttgaaattc
tttgcgcgcctgcaaactttcatactgtggttcgtggacgctgcctcctacatagacact
gatgacgcccaatggtgctactttgtttgctatgaaaagtataagaacggcgatggccag
tatcagtatgccacagctggctacacaaccgtgtacgagtactatgcctatccgcagaac
aagcggccacggattagccaaatgatgatattgccccccttccagaagctgggtctggcc
acccaactaatcgagactatatacaagtactaccagtcgcagaagaacgtggtggacatc
actgtagaagatccctcggaggactttcagcggctgcgaaattttgtagatgcgcgcttc
tgcaaggaactgaagtcatttgcccgcaacgagatcgtcaagggcttcagcaaggaaatg
gtgagagaggctcgcgaaactcttaaactaaatccgcgacaggtgcgaaaagtatacgag
ctgctacgcctgtactacaccaatgtgaatgatgaaaaggagtacagaagctatcgtctg
gaggtaaagaaacgccttaatgcagtttactataagcagatcaaggaccttaagaaaatg
gagcgctacaagatggacacggaaatgctgcgagctcgattgcccaacatgaagcagcgc
atggaacagcttcaggaagagtacgccgtggtcgaggagggctacaagaacacgctcgcc
aagctaaaggcctaa

DBGET integrated database retrieval system