KEGG   Drosophila persimilis: Dper_GL23052Help
Entry
Dper_GL23052      CDS       T01063                                 

Definition
GL23052 gene product from transcript GL23052-RA
Orthology
K04437  
filamin
Organism
dpe  Drosophila persimilis
Brite
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dper_GL23052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 269 aa AA seqDB search
MFKASQEMRLNTNAAASLCPSGSGGIEGPSAEKEGIFGRYQRTPDADAYPTEPPRVFIAP
ELTHAGRVQLLHFPSGAVRINSSVSFILKRNGVKGNFDVRVEGPSGQLEAVQQQQLDPER
FQIDCQLSSGAGLYKVHVKCNSVILPRSPFIIVAIAGAPEATETKSSSPAGLPIFQSDAS
KVQSRGLGLSHMSCLERNEFTVDCSQAGSNMLFVAILGPRGPCDEVLVKHLGRNVHRVTY
RVSDPGDYILVAKWGEQHIPGSPFSLATE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagcgtcgcaggagatgcgtctgaacaccaatgcagctgcctctctgtgtccg
agtgggagtggtgggatcgaggggccgagtgcggagaaagagggtatttttgggcgctac
cagcgcacgcccgacgcggatgcatatcccacagagccgccccgcgtcttcatagctccc
gagctgacccacgcgggcagggtgcaattgctgcactttcccagcggggctgtccgcatc
aacagctccgtcagcttcatcctcaagcggaacggtgtcaaagggaactttgatgttcgg
gtagagggtcctagcggccagctggaggccgtgcagcagcagcagttggacccggagcgc
ttccagatcgactgccagctgtcctctggtgcaggactctacaaggtgcacgtcaaatgc
aactccgtgattctgccccggtctcccttcatcatagtagccatagcgggagctcccgag
gccacggaaacaaaatccagcagtccagcaggattgcctatctttcagtcggatgccagc
aaggtacagagccggggcctaggactctcgcacatgagctgcctggagaggaacgagttc
accgtggactgcagccaggcgggtagcaacatgctcttcgtggccatcctgggaccacgg
ggcccttgcgacgaggtgctggtgaagcatctcggccgcaacgtacatcgggtcacgtac
cgcgtgtcggatcctggggattacattttggtggccaagtggggggaacagcacataccg
gggtcgcccttcagcctggccaccgaatag

DBGET integrated database retrieval system