KEGG   Drosophila persimilis: Dper_GL23135Help
Entry
Dper_GL23135      CDS       T01063                                 

Definition
GL23135 gene product from transcript GL23135-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dpe  Drosophila persimilis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dper_GL23135
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dper_GL23135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 763 aa AA seqDB search
MSATSHQLLGFSLETFKWQLWQQQQQHQQHQQAQPDNSPSPMVAYNQKPQNQSRSTSTVS
RKPRAEAQAQSQAVSRKPQSQLLLLLLAGPQSRDHLHVTSQRQVGHRTARIAHLLPALPR
IRVMGSLQHSLFYALAAALLILSLHLSGVCGVIDRLVVQTSSGPVRGRSVTVQGREVHVY
TGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEIWNPNTNV
SEDCLYINVWAPAKARLRHGRGANGAEHSGSKPADTDHLIHNGNPQNTTNGLPILIWIYG
GGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPADFAEEAPGNVGLW
DQALAIRWLKENAHAFGGNPEWMTMFGESAGSSSVNAQLVSPVTRGVVKRAMMQSGTMNA
PWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRGVDAKTISVQQWNSYSGILS
FPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALP
RDKYLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGHAVGDHFFTCPTNEYAQ
ALAERGASVHYYFFKHRSSTSLWGEWMGVMHGDEIEYFFGQPLNNSLQYRPVERELGKRM
LSAVIEFAKSGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPK
VRSWAGTGCDGDSGSASISPRLQLLLLAGLLYIGAALRTKGVF
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaacctcccatcaactgctgggcttcagcctcgagaccttcaagtggcaactg
tggcagcagcagcagcagcaccagcagcaccagcaagcacaaccggataatagtccttcg
ccgatggttgcgtacaaccagaaaccgcaaaaccagagccgttcaacatcgaccgtaagc
cgtaagccccgagccgaagcccaagcccaatcccaagccgtaagccgtaagccgcagagc
caactgctactgctactgctagccgggccccaaagccgagaccatttgcacgtgacgtca
cagcgtcaagtaggacacaggaccgcgcgaattgcgcatctgcttccggcgctgccgcgc
atccgcgtcatgggctcccttcagcacagcctcttctatgcgctggccgcggcgctgctg
atactttcgctgcacctctccggcgtctgcggcgtcatcgatcgcctggtggtgcagaca
tcgtcggggccggtgcgcggccgctcggtgacggtgcagggccgcgaagtgcacgtctat
acgggcatcccctacgccaagccgccagtcgaggacctgcgctttcgcaaaccggtaccg
gcggagccctggcacggcgtcctagacgccactcgtctatccgcgacctgcgtccaagag
cgctacgaatactttccgggcttctctggcgaggagatctggaaccccaacaccaatgtt
tccgaggactgcctgtacatcaacgtttgggcgccggccaaggcgcgtctacgccatgga
agaggcgccaatggtgccgagcactcgggctccaagccggcggacacggaccacctgatc
cacaatggtaatccgcagaacacgaccaatggattgcccattctgatctggatctacgga
gggggattcatgaccggctcggccaccctggacatctacaatgcggacatcatggcggcc
gtggggaatgtgatagtggcctccttccagtatcgcgtgggggcctttggtttcctccat
ctggcgccggaaatgccggcagacttcgccgaggaggcacccggcaatgtggggctctgg
gaccaggcgctggccatccgctggctgaaggaaaatgcgcacgccttcggcggcaatccc
gagtggatgaccatgttcggggagtcggcgggctccagctcggtgaacgcccagctggtg
tcgcccgtgacgcggggcgtggtcaagcgggccatgatgcagtcgggcaccatgaacgca
ccctggagccacatgacctccgagaaggccgtggagatcggaaaggcgctgatcaacgac
tgcaactgcaatgcctccatgctgaagaccaatcccgctcacgtgatgagctgcatgcgg
ggcgtggacgccaagaccatttcggtgcagcaatggaactcgtactcgggcatcctcagc
ttcccatctgccccaaccatagacggggcctttctgccggcggatcccatgaccctgatg
aagacggcggatctcaaggactacgacatactaatgggaaatgtcagggatgagggtacc
tacttcttgctgtacgatttcatcgattacttcgataaggacgatgccaccgccctgccg
cgcgacaagtatctggagattatgaacaacattttcggcaaagcaacacaggcggagcga
gaggccatcatattccagtacaccagctgggagggcaatccgggctatcagaatcagcag
caaattggacacgccgtgggcgatcacttcttcacctgccccaccaacgagtatgcccag
gcgctggccgagcgaggcgcctctgtgcactactacttctttaaacatcgctcaagcacc
tcgctgtggggcgagtggatgggcgtgatgcacggcgacgagattgagtacttcttcggc
cagccgctgaacaactctctgcagtatcgacctgtggagcgcgagctgggcaagcgtatg
ctcagtgcggtcatcgagtttgccaagtccggcaaccccgcccaagatggcgaggagtgg
ccaaacttctccaaggaggatcccgtctactacatattcagcacggatgacaagatcgag
aaactggcacgcggccccttggcggcccgctgttccttctggaacgattacttaccgaaa
gtcaggagttgggcaggtacaggttgcgatggcgactcgggaagtgcttccatatccccc
aggctgcagctcctgttgctggctggactgctctacatcggtgccgccttgagaaccaaa
ggagttttctaa

DBGET integrated database retrieval system