KEGG   Drosophila persimilis: Dper_GL23144Help
Entry
Dper_GL23144      CDS       T01063                                 

Definition
GL23144 gene product from transcript GL23144-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dpe  Drosophila persimilis
Brite
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dper_GL23144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESTDDRVNFRQFMNVLAHFRPLRDNKQSMLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
TKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaagtcatcactgttcctccggaacgaggagatagcgcagattcaggaggaa
actggttttactcccaaccaaatcgagagattgtactcgcgcttcacgtcgttggatcgc
aacgactgcgggaccctctcccgcgaggacctgatgcggatcccggagctggccatcaat
ccgctgtgcgagcgcatcgtccactcgttcttcgccgagagcaccgacgatcgggtgaac
tttcggcagttcatgaacgtgctggcccacttccgtccgctgagggataacaagcagagc
atgctcaacagccgggaggagaagctgaagttcgccttcaagatgtatgaccttgatgac
gacggcgtgattagccgggacgagctgctctccattctgcacatgatggtgggcgccaac
atcagccaggaccagctggtcagcattgcggagcgcacaatcctggaggcagacctctgc
tgccagggcaagatatcgttcgaggacttctgcaaggccctagaccgcaccgacgtcgac
acaaagatgtccataaggtttctcaactga

DBGET integrated database retrieval system