KEGG   Drosophila persimilis: Dper_GL23248Help
Entry
Dper_GL23248      CDS       T01063                                 

Definition
GL23248 gene product from transcript GL23248-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpe  Drosophila persimilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpe00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MFLRANAVLIAVGLLFLLASPSPSGAAPECLRGPEQCRERSMHPDLPEPKRAIRKVDGEE
TNAFWREQGVEFIRKQLATEPNKRQAKNVILFIGDGMGVTTTSAARNLIGGEEKSLSFEN
FPYTGLSKTYSVDKIVPDSACTATAYLCGVKGQEGTIGVNGVVPRTDCTSMLDESTHVDS
IAKWAMDAGKWAGLVTTTRVTHASPSGVYAHIAERDWENDAEVISDCGADSGIQDIAYQL
ARGEVGSKLKVILGGGRKNFVDSTLSEEGKRTDGLDLIEEFKATNAQNVFVDTVDDLMAV
NVTTTQRLLGLFNYDHIQYRMETAEDSPQPSLEQMTRKAIEYMSQSEQGYFLFIEGGRID
QAHHKNMARMALNETIEFSKAIAAAQELTNEEDTLLVVTADHSHVFSYAGYGYRGEDIFG
KAPVNGNDGQPYMVLSYANGPSYENFYDTETKERRDPTTVVTGAHDDQFPSGVPMYDDSH
GGDDVAVYAVGPWSHLFTGVYEQSTIPHLMAYAACLGEGHTMCST
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttcctccgagcaaacgccgttctgatcgccgtcgggcttctattcctgctggccagc
cccagtcctagtggggcagcgccggagtgcctgcgcggcccggagcagtgccgggagcgt
agtatgcatccggatctgccggagccgaagcgagcgattcgcaaggtggatggcgaggag
accaacgccttctggcgggagcagggtgtggagttcatcaggaagcagctggccacagag
ccgaacaagcgtcaggccaagaacgtgatcctcttcattggcgatggcatgggtgtgacc
acaacctctgcggcccgcaacctaatcgggggcgaggagaagtccctctccttcgagaac
ttcccctacacgggcctctcgaaaacctactccgtggacaagattgtccccgactcggcg
tgcacggccaccgcttatctgtgtggagtcaagggccaggagggcaccattggcgtcaac
ggagttgtgccccgcaccgactgcacttccatgctggacgagagcacccacgtcgactcg
attgccaagtgggccatggatgcgggcaagtgggcgggtctggtgaccaccacccgcgtg
acccatgcctctccctccggcgtctacgcccacattgccgagcgggactgggagaacgac
gcggaggtgatctccgactgcggcgccgactcgggcatccaggacatcgcctaccagctg
gcgcgcggcgaggtgggtagcaagctgaaggtgatcctcggcggcggacgcaagaacttc
gtggactccactctgtcggaggaggggaaacgcaccgatggcctcgacctgatcgaggag
ttcaaggcgaccaatgcccagaacgtcttcgtggacaccgtggacgacttgatggccgtg
aacgtgaccactacccagcgcctgctgggactcttcaactacgatcacattcagtaccgc
atggagacggcggaggacagcccccagccctcgctggagcagatgacgcgcaaggccatc
gagtacatgagccagagcgagcagggctacttcctgttcatcgagggcggtcgcatcgac
caggcccatcacaagaacatggcacgcatggccctgaacgagacgattgagttctccaaa
gcgattgccgccgcccaggagctgaccaacgaagaggacaccctgctggtggtcactgcg
gatcactcgcatgtgttcagctatgcaggatatgggtaccgcggcgaagacatctttggc
aaggcacccgtgaacggaaacgatggccaaccctatatggtcctgagctatgccaacggt
cccagctacgagaatttctacgacacggagacgaaggagcgcagggatcccaccaccgtg
gtgacgggcgcccacgacgaccagttcccctcgggcgtgcctatgtacgacgattcgcac
ggcggcgacgatgtggccgtctatgctgtgggtccctggtcgcatctgttcaccggcgtc
tacgagcagagcaccatcccccacctgatggcctatgccgcctgcctgggcgagggacac
accatgtgcagcacgtag

DBGET integrated database retrieval system