KEGG   Drosophila persimilis: Dper_GL23289Help
Entry
Dper_GL23289      CDS       T01063                                 

Definition
GL23289 gene product from transcript GL23289-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 293 aa AA seqDB search
MSGIQMIGLKTNALKYLIEQLPGVEKCSKYTPKYHKRNGNVSIAASAGGHASAGSGGSAA
ALAALAAAGADAQALLDYGSDQDELQENAYDCARCEPYATRSEYDMFSWLASRHRKQPIQ
VFVQPSDNELVPRRGTGSNLPMAMKYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEM
VIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHSCEPNCY
SKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcattcagatgattggcctgaagacgaacgccctcaagtacctcatcgagcag
ctgccgggggtggagaagtgctccaagtacacgcccaagtaccacaagcgcaacgggaat
gtgtcgattgcggcaagtgccggtggacacgcctccgcaggcagtggaggcagcgcagca
gcgctggcagccctggctgccgctggcgcggatgcccaagctttgctggactacggctcg
gaccaggatgagttgcaggaaaacgcgtacgattgtgcgcgctgtgagccgtatgcgact
cgatccgaatacgacatgttcagctggctggcctccaggcaccgcaagcagcccattcag
gtgtttgtgcagccctcggacaacgagctggtcccaagaagaggaacgggcagcaatcta
ccgatggccatgaagtacaggaccttgaaggagacctacaaggactatgtgggcgtattc
cgttcccatatccatggacgtggtctctactgcaccaaggacatcgaagcgggtgaaatg
gtcattgaatacgctggcgagctgattcgctccacgctgacggacaagagggagcgctac
tacgacagtcgcggcatcggctgctacatgttcaagatcgatgacaacctggtggtggat
gccaccatgcggggcaatgcggcccgtttcatcaatcactcctgtgagccaaattgctac
tcaaaggtcgtcgatatactggggcacaagcacatcattatctttgcgctgcgccgcatt
gtgcagggcgaggagctgacctacgattacaagttccccttcgaggacgagaagataccc
tgctcgtgcggctccaagcgatgccgcaagtacttaaattag

DBGET integrated database retrieval system