KEGG   Drosophila persimilis: Dper_GL23289Help
Entry
Dper_GL23289      CDS       T01063                                 

Definition
GL23289 gene product from transcript GL23289-RA
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL23289
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dper_GL23289
Transcription factors [BR:dpe03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dper_GL23289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 293 aa AA seqDB search
MSGIQMIGLKTNALKYLIEQLPGVEKCSKYTPKYHKRNGNVSIAASAGGHASAGSGGSAA
ALAALAAAGADAQALLDYGSDQDELQENAYDCARCEPYATRSEYDMFSWLASRHRKQPIQ
VFVQPSDNELVPRRGTGSNLPMAMKYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEM
VIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHSCEPNCY
SKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcattcagatgattggcctgaagacgaacgccctcaagtacctcatcgagcag
ctgccgggggtggagaagtgctccaagtacacgcccaagtaccacaagcgcaacgggaat
gtgtcgattgcggcaagtgccggtggacacgcctccgcaggcagtggaggcagcgcagca
gcgctggcagccctggctgccgctggcgcggatgcccaagctttgctggactacggctcg
gaccaggatgagttgcaggaaaacgcgtacgattgtgcgcgctgtgagccgtatgcgact
cgatccgaatacgacatgttcagctggctggcctccaggcaccgcaagcagcccattcag
gtgtttgtgcagccctcggacaacgagctggtcccaagaagaggaacgggcagcaatcta
ccgatggccatgaagtacaggaccttgaaggagacctacaaggactatgtgggcgtattc
cgttcccatatccatggacgtggtctctactgcaccaaggacatcgaagcgggtgaaatg
gtcattgaatacgctggcgagctgattcgctccacgctgacggacaagagggagcgctac
tacgacagtcgcggcatcggctgctacatgttcaagatcgatgacaacctggtggtggat
gccaccatgcggggcaatgcggcccgtttcatcaatcactcctgtgagccaaattgctac
tcaaaggtcgtcgatatactggggcacaagcacatcattatctttgcgctgcgccgcatt
gtgcagggcgaggagctgacctacgattacaagttccccttcgaggacgagaagataccc
tgctcgtgcggctccaagcgatgccgcaagtacttaaattag

DBGET integrated database retrieval system