KEGG   Drosophila persimilis: Dper_GL23516Help
Entry
Dper_GL23516      CDS       T01063                                 

Definition
GL23516 gene product from transcript GL23516-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dpe  Drosophila persimilis
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dpe00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 305 aa AA seqDB search
MASTAPVIMRIMASSIQTAKLAGGIIRDVLKQGDLGIVDKGKNDPQTEADRSAQRCIIAS
LTKKFPGVKIIGEEGGSDLNVCDDWLVEDLDEEFLQKSCPAEWRDAKPEDFVIWVDPLDG
TAEYTQGYVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGELGRTIWGLKGLGTGGFTHSL
APPGEFIITTTRSHSNALHQQALNAFPATKILKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGFLTDINGKNYSYNADVEHVNRQGVLASVGENHSELVYKIPRKVR
EAVGV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactgctccggttatcatgagaattatggcgtcttccatacagacagccaaa
ctagctggtggcatcatacgcgacgtcctaaaacaaggcgacctaggcatcgtggacaag
ggaaaaaatgatccccaaacggaggctgatcgttctgcccagcggtgcatcattgcctcg
ctgacgaaaaagtttcccggtgtaaagatcattggcgaggaaggcggctccgacttaaac
gtgtgcgatgattggctggtcgaagatttggatgaagagtttcttcagaaaagctgcccg
gccgaatggcgtgatgcaaaacctgaggattttgtgatctgggtagatccattggacgga
acagctgaatatacacagggttacgtggaacatgtcaccgtactcataggcatagccgtc
aaggatgctgcggtgggcggaatcattcatcagccgttttaccagcagcccgatggtgag
ctgggtcgcaccatttgggggctcaagggtctgggcacgggcggtttcacacattcgctg
gctccacccggagagttcatcataacgaccacacgatcgcactcgaatgccctgcaccag
caggcactcaatgcatttcctgccaccaaaatcctgaaagtgggcggcgctggattcaag
gtgttgcagctgctagagggcaaggcacacgcatatgtgtttgccacaccaggatgcaag
aaatgggatacttgcgcccccgaggccgtgctggaggcacagggcggctttctcacagac
atcaatggcaagaattattcctacaatgctgatgtggagcacgtgaatcggcagggagtg
ctggccagcgtgggcgagaatcactcggagctggtgtacaaaattccccgtaaggtgcgg
gaggctgtaggagtatga

DBGET integrated database retrieval system