KEGG   Drosophila persimilis: Dper_GL23516Help
Entry
Dper_GL23516      CDS       T01063                                 

Definition
GL23516 gene product from transcript GL23516-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dpe  Drosophila persimilis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dper_GL23516
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dper_GL23516
Transfer RNA biogenesis [BR:dpe03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dper_GL23516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 305 aa AA seqDB search
MASTAPVIMRIMASSIQTAKLAGGIIRDVLKQGDLGIVDKGKNDPQTEADRSAQRCIIAS
LTKKFPGVKIIGEEGGSDLNVCDDWLVEDLDEEFLQKSCPAEWRDAKPEDFVIWVDPLDG
TAEYTQGYVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGELGRTIWGLKGLGTGGFTHSL
APPGEFIITTTRSHSNALHQQALNAFPATKILKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGFLTDINGKNYSYNADVEHVNRQGVLASVGENHSELVYKIPRKVR
EAVGV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactgctccggttatcatgagaattatggcgtcttccatacagacagccaaa
ctagctggtggcatcatacgcgacgtcctaaaacaaggcgacctaggcatcgtggacaag
ggaaaaaatgatccccaaacggaggctgatcgttctgcccagcggtgcatcattgcctcg
ctgacgaaaaagtttcccggtgtaaagatcattggcgaggaaggcggctccgacttaaac
gtgtgcgatgattggctggtcgaagatttggatgaagagtttcttcagaaaagctgcccg
gccgaatggcgtgatgcaaaacctgaggattttgtgatctgggtagatccattggacgga
acagctgaatatacacagggttacgtggaacatgtcaccgtactcataggcatagccgtc
aaggatgctgcggtgggcggaatcattcatcagccgttttaccagcagcccgatggtgag
ctgggtcgcaccatttgggggctcaagggtctgggcacgggcggtttcacacattcgctg
gctccacccggagagttcatcataacgaccacacgatcgcactcgaatgccctgcaccag
caggcactcaatgcatttcctgccaccaaaatcctgaaagtgggcggcgctggattcaag
gtgttgcagctgctagagggcaaggcacacgcatatgtgtttgccacaccaggatgcaag
aaatgggatacttgcgcccccgaggccgtgctggaggcacagggcggctttctcacagac
atcaatggcaagaattattcctacaatgctgatgtggagcacgtgaatcggcagggagtg
ctggccagcgtgggcgagaatcactcggagctggtgtacaaaattccccgtaaggtgcgg
gaggctgtaggagtatga

DBGET integrated database retrieval system