KEGG   Drosophila persimilis: Dper_GL23561Help
Entry
Dper_GL23561      CDS       T01063                                 

Definition
GL23561 gene product from transcript GL23561-RA
Orthology
K11252  
histone H2B
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactagtggaaaggcagccaaaaaggctggaaaggctcagaagaacatc
accaagaacgacaagaagaagaagcgcaagaggaaggagagctatgccatctatatttac
aaagttctgaagcaagtccatcctgacactggtatttcgtcgaaagcgatgagcatcatg
aacagctttgtaaatgacatcttcgagcgcattgctgccgaggcgtctcgcttggctcat
tacaacaagcgctcaaccatcaccagtcgggaaatccaaacggctgtgcgcctgctgctg
ccgggagagctggccaagcacgctgttagtgagggaaccaaggctgtcaccaagtacacc
agctccaagtaa

DBGET integrated database retrieval system