KEGG   Drosophila persimilis: Dper_GL23677Help
Entry
Dper_GL23677      CDS       T01063                                 

Definition
GL23677 gene product from transcript GL23677-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dpe  Drosophila persimilis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dpe03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 279 aa AA seqDB search
MIKRKLALRTAELSDEHPKKAPMSEETTSALFAQSPWQQFYNIEVSLNEALETFATPPTI
SCTYNPVEYASSLHCAYLRRFLDGPKRVMFIGMNPGPTGMAQTGIPFGNVRTVSELMEIS
GEVGRPPVIHPKRPVVGLQCKTEERSGVRLWELFLRLAGGRLDTFSRQCFVHNFCPLAFF
DAAGKNITPTELKGPYKQKIRDVCLDALEKQLQIVRPQVVVAVGDYVYQTLQRSEYCKAV
SLLRLAHPSPRSVNNTNWPEKAQEFLEQHGLIQFMRNEV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcgaaagctagccctgcggacagcggaactgtctgatgagcaccccaaaaaa
gcacccatgagtgaagagaccacatctgctctgtttgctcagtccccgtggcagcagttc
tacaacattgaagttagcctcaatgaggcgcttgaaacctttgccacgcccccgaccatt
tcatgcacatacaatcccgtggagtacgcgtcatccctgcactgcgcctatttgcgccgc
tttctagatggaccgaagcgcgtcatgttcataggcatgaatccgggacccactggcatg
gctcaaacgggaattccctttggcaatgtgcgcactgtaagcgagttaatggagatctcc
ggagaggtcggaaggccgccagtaatccatcctaagcgaccagttgtgggcttgcagtgc
aaaacagaggagcgtagtggggtgcgcttgtgggaactatttctacgtttggcgggcggc
cgactagacacattttcgcgacaatgctttgtgcataacttttgtccacttgccttcttc
gatgctgccggaaaaaacataacaccgaccgagctaaagggtccgtacaagcagaagatc
cgtgacgtttgcttggatgccttggagaagcagttgcagattgtcaggccccaggtggtg
gtggctgtgggcgattatgtgtatcaaacgttgcagcgctcggaatactgcaaagcggtg
tctttgctgcgtttggcgcatccaagtccgcgttctgtaaacaacacaaattggccagag
aaggctcaggagtttctggagcagcatggcttgatacagttcatgcgtaatgaggtataa

DBGET integrated database retrieval system