KEGG   Drosophila persimilis: Dper_GL23766Help
Entry
Dper_GL23766      CDS       T01063                                 

Definition
GL23766 gene product from transcript GL23766-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dper_GL23766
Peptidases [BR:dpe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dper_GL23766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MGANVSQLEREIGSDLFPANEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPSHGNGNGNGKSSARPANRAHVNSNSNSNSTSNSTTTNGNSSNSTGS
LNAAAGAAAATTSVLDASGGLTATTTPLVQTNGANSEPTWVHEIFQGILTSETRCLNCET
VSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKL
PMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGS
GPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSRDC
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaacgtctcgcagctggagcgggagatcggctcggatctgtttccggccaat
gagcactacttcgggctggtgaacttcggtaacacctgctacagcaactcggtgctgcag
gccctgtacttttgcaagcccttccgcgagaaggtgctcgagtacaaggcgaagaacaag
cggcccaaggagacgctactctcctgcctggcggatctcttctacagcattgccacgcag
aagaagaaggtcggctccattgcccccaagaagttcatcacgcggctgcgcaaggagaag
gaggagttcgacaactatatgcagcaggatgcccacgagtttctcaactttctgatcaat
cacatcaacgagatcatcctggccgaacggaacgccggaccctcgcatggcaatggcaac
ggcaatggaaagtcgagcgcacggccagcaaatcgagctcacgtcaactcgaactcgaac
tccaattcgacctccaattcgacgacaaccaatgggaacagcagcaactccacgggctcc
ctgaatgccgcggccggcgccgccgccgccaccacgagtgtcctggatgccagcggcggt
ctgacggccacgaccacgcccctggtgcagacgaacggcgccaattcggagcccacctgg
gtgcacgagatctttcagggcattctgacgtccgagacgcgttgcctcaactgcgagacg
gtgagcagcaaggacgagaacttctttgatctccaggtggacgtcgatcagaacacatcg
atcacgcactgtctgcggtgcttcagcaacacggagaccctctgttcggacaacaaattc
aagtgcgacaactgctgcagctaccaggaggcccagaagcggatgcgcgtcaagaagctg
cccatgatattggccctgcacctgaagcgattcaagtacatggagcaattcaatcgccac
atcaaggtctcgcatcgcgttgtctttccgctcgaattgcggctgttcaacacctccgac
gatgccgtcaatccggatcgactgtacgatctaacggccgtggtcatacactgcggttcg
ggcccaaatcgtggccactacatcagcatcgtgaagagtcacggcctctggctgctgttc
gacgatgatatggtcgataagattgaggcctccaccatcgaggacttttacggcctcacc
tcggacatacacaagtcctcggagacgggctatatattattctatcagtcaagggattgc
gcctag

DBGET integrated database retrieval system