KEGG   Drosophila persimilis: Dper_GL23914Help
Entry
Dper_GL23914      CDS       T01063                                 

Definition
(RefSeq) GL23914 gene product from transcript GL23914-RA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00260  Glycine, serine and threonine metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
dpe01230  Biosynthesis of amino acids
Module
dpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpe_M00002  Glycolysis, core module involving three-carbon compounds
dpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL23914
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dper_GL23914
Enzymes [BR:dpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dper_GL23914
Membrane trafficking [BR:dpe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dper_GL23914
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dper_GL23914
  Exosomal proteins of melanoma cells
   Dper_GL23914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 6587448
NCBI-ProteinID: XP_002013043
FlyBase: FBgn0161504
UniProt: B4G2I4
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSDKGKEEAQAAGKAVKDAGLEFDVAHTSV
LTRAQVTLASILQASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHAYYDNIVKDPRYADGPKPEEFPQFESLKLTIERTLPYWNEVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaaagtacaagattgtgatggtccgccacggcgagtccgaatggaaccagaag
aatcagttctgcggctggtacgatgccaatctgagcgacaagggcaaggaggaggctcag
gccgctggcaaggccgtgaaggacgctggtctggagttcgatgtggcccacacttcggtg
ctgactcgcgctcaggttaccctggcaagcattctgcaggccagcggccacaaggagatc
cccatccagaagacctggcgtctgaatgagcgtcactacggtggactcactggcctgaac
aaggcggagactgccgccaagtacggcgaggctcaggtgcagatctggcgccgcagcttc
gacacaccgccaccaccaatggagcccggacacgcctactatgacaacattgtcaaggat
ccccgctacgccgatgggcccaagcccgaggagttcccccagtttgagtcgctcaaactg
accatcgaacgcacactgccatactggaacgaagtgatcattccccagatgaaagagggc
aagcgcatcctgatcgcagcgcacggcaacagtctccgtggcatcgtcaagcatttagat
aatctgtctgaggacgccattatggccctgaacttgcccactggcataccattcgtctat
gagctggacgagaacttcaagccagtggtgtccatgcagttcctcggcgatgaggagacc
gtcaagaaggccatcgaggctgtcgctgcccagggcaaggccaagtaa

DBGET integrated database retrieval system