KEGG   Drosophila persimilis: Dper_GL24141Help
Entry
Dper_GL24141      CDS       T01063                                 

Definition
GL24141 gene product from transcript GL24141-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dper_GL24141
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dper_GL24141
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dper_GL24141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSASKTQKFYKLDINRTEWEIPDIYQNLQPVGSGAYGQVSKALVRGTNMHVAIKKLARPF
QSSVHAKRTYRELRLLKHMDHDNVIGLLDIFHPHPANTSLESFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWQHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMKKISSESARNYILSLPPMKRRSFKKVFENANPLAIDLVEKMLELDAEKR
ITAEEALAHPYLEKYSEPSDEHTSPLYDQSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLQEMK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgtcaaagactcaaaagttctacaaattggacataaaccgcacagaatgggag
atccctgacatctaccagaacctgcagcccgtgggttctggtgcctatgggcaggtctcg
aaggctctggttcggggaaccaatatgcatgtggccataaagaagctggcacgccctttt
cagtcgtccgtacatgcgaagcgtacgtatcgagagctgcgactgctgaagcatatggat
catgacaatgtgatcggactgctggacatattccaccctcatccggcgaacacgtcgctg
gagagctttcaacaggtgtacctggtcacccacttgatggatgcggatctaaacaacatc
atacggatgcagcacctgtccgacgatcacgtacaattcctggtctaccagatactcagg
ggtctaaagtacattcacagtgccggtgttattcatcgcgacctgaagccgtccaacatt
gcagtcaacgaagactgcgagctgcgtattctcgacttcggactggcgcggccaacagag
aacgagatgaccggctatgtggccacacgttggtatcgggccccggagatcatgctcaac
tggcagcactacaaccaaacggtggacatctggtcggtgggctgcataatggcagagctg
atcacacgacgcactctctttccgggcaccgatcatattcatcagctaaatctgatcatg
gagatgctgggcacgccgcccgacgacttcatgaagaagatctcctcagagagtgctcgg
aattacattttgtcactgccgcccatgaagagacgaagctttaagaaggtgtttgaaaac
gctaatccgttggccatcgatttggtggagaagatgctcgagctggatgccgagaagcgt
atcacagccgaagaagccttggcccatccgtacttggagaagtactctgagcccagcgac
gagcacacctcaccgctgtacgatcaaagtttcgaggacatggatctcccagtggacaag
tggaaggaactcatttacaaagaggtcacaaacttcaagccgccaccgtctttcgctcag
gttctacaggaaatgaaatga

DBGET integrated database retrieval system