KEGG   Drosophila persimilis: Dper_GL24147Help
Entry
Dper_GL24147      CDS       T01063                                 

Definition
GL24147 gene product from transcript GL24147-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpe03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpe04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 231 aa AA seqDB search
MSMEKVATKQYESKVWPDLVDSDDSDVENEIDVEKLPPLEVGPNENRLQHTYCLWFSRKG
TQRAATDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPYRELSLFKQGIKPMWEDPANS
KGGQWLIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKYPVSEKPFHSICTIFT
TWKPCKRVLCNILNLCLIVCCNPAGSTYLFFYIYLPRLLPIGKFLFRLKFV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggaaaaggttgcaaccaaacaatatgaatcgaaagtctggccggatcttgtc
gacagtgacgacagcgacgtagagaatgaaatagatgtggaaaaattaccgccgctggag
gtggggcccaatgagaatcgcctgcagcacacatactgcctttggttctcgcgaaagggg
acacagcgggccgccacggactatagcaaatcgctgcacgtggtcggaaggtgtgcaagt
gtccagcaatggtggtccctctactcgcatctgatccggccgactgccctgaagccgtac
cgagagctgtccctattcaaacaaggcatcaaaccgatgtgggaggatccggcgaatagt
aaaggcggccaatggctgataagattgcgcaaaaacaaaattgaacgtgcctgggagaat
gtctgcatggcgatgctgggtgagcaatttctggtgggtgacgagatatgcggcatagtg
ctgcagacaaagtatccggtgagtgagaaaccattccattctatttgtaccatatttaca
acctggaaaccgtgcaaacgagtgctttgcaatattttgaatttatgtctgatcgtatgc
tgcaaccctgccggctcaacatatctatttttctatatatatttgccaagattattgcca
attggcaagttccttttcagattgaaattcgtttaa

DBGET integrated database retrieval system