KEGG   Drosophila persimilis: Dper_GL24147Help
Entry
Dper_GL24147      CDS       T01063                                 

Definition
GL24147 gene product from transcript GL24147-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL24147
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dper_GL24147
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dper_GL24147
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dper_GL24147
Translation factors [BR:dpe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dper_GL24147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 231 aa AA seqDB search
MSMEKVATKQYESKVWPDLVDSDDSDVENEIDVEKLPPLEVGPNENRLQHTYCLWFSRKG
TQRAATDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPYRELSLFKQGIKPMWEDPANS
KGGQWLIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKYPVSEKPFHSICTIFT
TWKPCKRVLCNILNLCLIVCCNPAGSTYLFFYIYLPRLLPIGKFLFRLKFV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggaaaaggttgcaaccaaacaatatgaatcgaaagtctggccggatcttgtc
gacagtgacgacagcgacgtagagaatgaaatagatgtggaaaaattaccgccgctggag
gtggggcccaatgagaatcgcctgcagcacacatactgcctttggttctcgcgaaagggg
acacagcgggccgccacggactatagcaaatcgctgcacgtggtcggaaggtgtgcaagt
gtccagcaatggtggtccctctactcgcatctgatccggccgactgccctgaagccgtac
cgagagctgtccctattcaaacaaggcatcaaaccgatgtgggaggatccggcgaatagt
aaaggcggccaatggctgataagattgcgcaaaaacaaaattgaacgtgcctgggagaat
gtctgcatggcgatgctgggtgagcaatttctggtgggtgacgagatatgcggcatagtg
ctgcagacaaagtatccggtgagtgagaaaccattccattctatttgtaccatatttaca
acctggaaaccgtgcaaacgagtgctttgcaatattttgaatttatgtctgatcgtatgc
tgcaaccctgccggctcaacatatctatttttctatatatatttgccaagattattgcca
attggcaagttccttttcagattgaaattcgtttaa

DBGET integrated database retrieval system