KEGG   Drosophila persimilis: Dper_GL24199Help
Entry
Dper_GL24199      CDS       T01063                                 

Definition
GL24199 gene product from transcript GL24199-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dper_GL24199
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dper_GL24199
Spliceosome [BR:dpe03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dper_GL24199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 381 aa AA seqDB search
MLARLPKQTAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCM
ALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMVDWFDYHGHMCIVFEMLGLSV
FDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYSAHYNHK
INREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCI
LFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYV
RDHCKPLFLCQLSDSEDHCELFGLIKKMLEYEPSSRITLGEALRHPFFDRLPPHQRVGEM
SSKQPLSSGSSSRERSHSLSR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgcttgcccaaacagacagccaagcccgtcatccaagatgatgctgatggt
cacttaatttaccacaccggagacattctccaccacagatataagatcatggccacactc
ggcgagggcacattcggacgtgtggtcaaagtaaaagacatggagcgtgattactgcatg
gccttaaagattatcaagaatgtggaaaagtatcgcgaagctgccaagctggagatcaac
gccttggagaagattgcacaaaaggatccgcattgtgatcacttgtgcgtgaaaatggtt
gactggtttgattaccatggacatatgtgcatagtttttgagatgttgggtctaagtgtt
ttcgattttttgcgagagaacaactatgagccatacccgctggaccaagtgcgccacatg
gcctatcaattatgctattctgtgaaatttttacatgacaatcgtttaacgcacacagat
ctcaagccggagaacatattgtttgtcgactcggattactcggctcactataaccataag
attaaccgggaggttcgacgtgtcaagaacacggacgttcgtctgattgacttcggttcg
gccaccttcgatcatgagcaccacagcacaattgtctcgacgcgacactatcgcgcgccc
gaagtcatactggagctgggctggtcacagccatgcgatgtctggtccattggctgcatc
ttgtttgagctatatctgggaatcacactcttccaaacgcacgacaatcgcgagcatctg
gccatgatggagcgcatcttgggacaaataccatatcgcatggcacgcaaaaccaaaaca
aagtacttctaccacggtaagttggattgggatgagaagtccagtgcgggacgctacgtg
cgcgaccactgcaagccgttgttcctgtgccaactgagcgacagcgaggaccactgcgag
ctgtttggcttgatcaagaagatgctggagtatgagccatcatcccgcatcacgttaggt
gaggccctacgccatcccttctttgaccggctgccaccgcaccagcgggttggtgaaatg
agcagcaagcagcccctctcgtcgggcagcagcagccgcgagcgatcgcacagtctgtcc
agatga

DBGET integrated database retrieval system