KEGG   Drosophila persimilis: Dper_GL24314Help
Entry
Dper_GL24314      CDS       T01063                                 

Definition
GL24314 gene product from transcript GL24314-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dper_GL24314
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dper_GL24314
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dper_GL24314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 606 aa AA seqDB search
MPAKNCGCRKKKEVRVHVIYTGGTIGMMRNSSGVLAPARKELTARLREYPNCHDKQYKSV
QPENSSLMVLPMVEGAPCRILYDLVEYCPLLDSSCMGFDEWKQIAKDVFNAYKSYDGFVI
LHGTDTLAYTASALAFMLENLNKPVVLTGAQIPIFETRTDGRDNFLGSLLLAGQYNIPEV
LVFFGNKILRGCRTSKINADSFHAFDSPNQPPLGQSGIKFEINNRQIFRPCNIGEFSVHC
CLERNVGILRMYPGITTAVMCAFLREPMKGVVLQSFGAGNIPANREEILDVLREAVGRGV
LVVNITQCSVGIVAPIYESGSVLTEIGVIPGYDMTPEAALTKLAYVLGKCEWDLANKKKV
MHLSLRGELTTNKLAKINDIDLIEGVARTLHMSSSVEREQMCSIFYPALVSAAVMSGDVE
KLGDLKQYGADLCDENCDGRTALHLACYLGKLNCVSFLLSVGCAVNVHDRFNRTPLHEAV
DTDNHDVIKALLCQGAVLSDPPEVQAELLRALTERGKIKRMESYRLAGADLTLADRTGRT
AMHYACQLGNHEVVDYLLPFYKNPYVKDELGMTPIDYAKAAHHDHIVTLLRFRENNYKKD
PCGCIN
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaaaattgtgggtgccgcaagaagaaggaagtccgcgtacatgtcatctat
acgggtgggacaatcgggatgatgcggaattcatcgggagtgctggcccctgcccgcaag
gaattgacggcacggttgcgcgaatatcccaactgtcatgataaacaatataagtccgtc
cagccagagaattcgtcgcttatggtgctgcccatggtggagggtgcaccttgtcgtatc
ctgtatgatctggtggagtactgtcccttgttggattccagttgcatgggctttgacgag
tggaagcaaatagccaaggacgtgtttaatgcttacaagtcctatgacggctttgtcata
cttcatggcacggatacgttggcatacacggcctctgctctagctttcatgttggagaat
ctcaacaaacccgttgtgttgacgggggcacaaatccccattttcgagacccgcaccgat
ggccgggacaattttctgggatctctgctcttggcgggccaatataacattccggaagtc
cttgttttctttggcaataagatcctgcggggctgtcgcacctccaagatcaacgccgac
tccttccatgccttcgactcgccaaatcagccaccactgggccagtcgggcattaaattt
gagatcaacaaccgccaaatattccgtccctgcaacatcggggagttttcggtgcactgc
tgcttggagaggaatgtgggcatattgcgcatgtatccaggcataactaccgccgtgatg
tgtgccttcctcagggagcccatgaagggtgtggtcctgcagagtttcggggccggcaac
atcccagcgaatcgtgaggaaatcctagacgttctgcgcgaggcggtcggcaggggtgtc
ctagtggtcaatattacgcagtgttccgtcggaatcgttgcccccatttacgagtccggc
agtgttctcacggaaataggtgtgattcctggctatgatatgactccagaggcagctctc
accaagttggcctacgtgctgggcaagtgcgaatgggatctggcgaacaagaagaaggtg
atgcacctgagcctccgcggggagctgaccaccaataagctggccaaaatcaacgatatc
gacctgattgagggcgtggcacgcactctgcacatgtcctcctcggtcgagcgggaacag
atgtgctcgatcttctatcccgcactggtgtccgctgccgtcatgagcggcgatgtggaa
aagctgggggatctcaagcagtatggggctgatctgtgtgacgaaaactgtgacggtcgc
accgccctgcacctggcctgctatctgggcaagctgaactgcgtgagctttttgctgtcc
gttggctgtgcggtgaatgtccacgatcggtttaaccgcacgccgctgcacgaggccgtc
gacacggacaatcatgacgtgataaaggctctgctctgccaaggggctgtcctcagcgac
cctccggaggtgcaggcggaactgctgcgcgccctgacggagcgcggcaagatcaaacgc
atggagtcctatcggctggccggcgccgatttaaccctggcggatcgcacgggacgcacg
gctatgcattatgcctgccagttgggcaaccacgaagtggtcgactatctcctgcccttc
tacaagaatccctatgtgaaggacgagctgggcatgacgcctatagattacgccaaggcc
gcccatcatgaccacatcgtgacgttgctgcgcttcagggagaacaactacaagaaggat
ccatgtggctgtataaattag

DBGET integrated database retrieval system