KEGG   Drosophila persimilis: Dper_GL24734Help
Entry
Dper_GL24734      CDS       T01063                                 

Definition
GL24734 gene product from transcript GL24734-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dpe  Drosophila persimilis
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dper_GL24734
Protein kinases [BR:dpe01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dper_GL24734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2481 aa AA seqDB search
MSTSSVVQNFVNGLKSRNRNVQNKAAQDLFLYVKTELREMSQEELAQFFDEFDHHIFNMV
NAADINEKKGGALAMKCLITSDGLTTRKGISPYLNRLRDLLLINDVSVMEIAARSLVKLA
NMPGSKGADSFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEHI
FNAIFDPKPAIRESAGEALRAALIVTAQRENTKQSSEPQWYKICYDEASASFNQDVATGK
EQKGMTRDDRIHGGLIVFNELFRCANASWERRYTALKTLFPKAHHNKFLEASSHSSMSSQ
LNTFVPRLKVPFIDKLGSTQMHMEAEHHHNGMAKFASHNVLESAYAHEILQAHYTTICDN
VLEQRFSKSPYVQQALLQILPRLAAFNREVFVDKYLQICVPHLMQILRGKEKDRTVAYIT
IGYLAVAVESAIEKYLETIMSCVKMALPAKDLASSKRKAPVDPAVFACITLLAHAVRSEI
VKDVRDILEQMFSTGLSPALTVCLRELSENVPQLKSGITDGLIGVLSQVLMNKPAAIPYA
ALPPIAIDGSLIMQMADGGTTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLE
AVQTCTRLLKLAVQSAESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETF
DAKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKY
SGMNRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDL
AEVNGGSNEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPV
LIDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVD
ESQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIK
CVPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMSDIFKLIKEFWTIN
TPLQSTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGS
TLGYYLPLIVPPIVKLFDSPYVPQQVSLVALETINNLACQLDFTDFSSRIIHPLVRVLDT
EPELRDQAMTTLRSLVKQLGKKYLVFVPMVQRILTKHRIGDSEYDKLLIRLQNNSTLADA
CGSGEFGLRQAKIKYNEPFVTDRNSNNRNLQVSTNVLRTAWQVTRRVSKDDWVEWLKRLS
IGLLKESPSHALRACCSLAQEYDTLLRDLFNAAFISCWTELSPEHKHELTQSLIQALQVT
DMPEITQTILNLAEFMEHCDRDPIPIETNLLGTRAMACRAYAKALRYKEEEFLLKEEASV
FESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYERNLQTDSS
DLEARLGHMRCLEALGDWSELSQVTKREWEGFGTEARARASPLAAVAAWGLQDWEAMREY
VRCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVC
VQMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIHT
WLKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPDEKLPCNQPQVTFAYTKYMAASNQLQE
AYDQLRCFVDKYSTELSCLPPEAVKPQDQRLMARCYLRLATWQNKLQERLCPGAIQGDLE
CFEKATSYDPNWYKAWHRWAYMNFKVVQAQKTALDKQQASLPPGLNIGIGLSMDSDMLII
QQYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYDALMSGMKLIEINTWLQ
VIPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDS
MRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAM
LERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQ
LTSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISHIKTNLQVITSKQRPRKLCIRGS
NGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLI
GWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEYALGQTQGD
DLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHID
FGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAV
LEAFVYDPLLNWRLLDVDKKGNDAAGANGGGAAGRGGSGMQVGNSGDSLSNSVEDSLPMA
KSKTYEAQLLLQQAGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTQKSVNEQQQVELL
IQQATNNENLCQCYIGWCPFW
NT seq 7446 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcttcggtggtgcagaatttcgtgaacggtctaaagtcccgcaatcgcaat
gtccagaacaaagccgcccaagacctcttcctgtatgtcaaaacggagctgcgagaaatg
tcccaggaggagctggcgcagttctttgatgagtttgatcatcatatattcaacatggtg
aatgcggcggacatcaatgagaagaaaggcggggcattagccatgaagtgccttatcacc
agcgatggtctgaccaccagaaaaggcatctccccgtatcttaatcgcctacgcgatctg
ttgcttatcaacgacgtgtccgtcatggaaattgctgcccgttccctggtcaaattggcc
aatatgcctggctccaagggcgccgactccttcgattttgacatcaaaaaggcctttgag
atgctcagcggcgacagacaagagtatcgtcgccatgctgcggtctttatcctacgggag
ttggctatagcattgcccacgtatttctaccagcaaatcctcaccttcttcgagcacatt
ttcaatgcaattttcgatcccaagcctgccatacgtgagtccgctggcgaggccttgagg
gccgccctcattgtgaccgcacagcgggagaacaccaagcaatcgagtgagccgcaatgg
tataagatctgctacgatgaggccagtgccagtttcaaccaggatgtggccacgggcaag
gagcagaagggcatgactcgcgacgatcgcatacatggcggccttatagtgttcaatgag
ctctttcgctgcgccaatgccagctgggagcgacgctatacggcgctgaaaacgctcttc
cccaaggcgcatcacaacaaatttctggaggccagcagccactcgagcatgagttcacag
ctgaacacgtttgtgccgcgcctgaaggtgccattcattgacaaattgggcagcacacag
atgcacatggaggccgagcatcatcacaatggaatggcaaagtttgccagccataacgtt
ttggaatcggcctatgctcatgagatactgcaggcgcactataccaccatctgcgacaat
gtgctggagcaacgcttctctaaatccccctatgtgcagcaggccctgcttcaaatactg
ccccgtttggcggcctttaatcgagaggttttcgtggataaatacctgcagatctgcgta
ccacatttgatgcaaatactgcgtggcaaagagaaggatcgcactgtggcctatatcacc
attggctacctggccgtggccgtggagagtgccattgaaaagtatctggagaccatcatg
tcctgcgtaaagatggctctacccgccaaggatttggccagcagcaagcgcaaggccccc
gtcgatccggcagtgtttgcctgcatcacgttgctggcgcatgccgttcgttcggaaatt
gtcaaggatgtgcgggacatactagagcaaatgttctccacgggcctgtcgcctgcgctg
accgtctgcctacgtgagctgtctgagaatgtgccgcagctcaagtcgggcatcaccgat
ggtctgattggggtgctctcgcaggttctaatgaacaagccggcggccattccatacgcc
gccctgccacccattgccattgatggctctctgataatgcagatggctgatggcggcacc
acagtgctggccctcaagacattgggaacgtttaactttgaagagcagaatatgttggac
tttgtgcagcgctgcgctgactacttcatcgttcacgaacagcaggagatacgcctggag
gcagtgcagacgtgcacgcgtctgctaaagctggccgttcagtccgcggagagcatggag
aactccaaaaccctgagcgacaccgtttcccatgtgattgagcgcctgctgatggtggcc
atcacggacatggactgtaatgtgaggatacggattctacgctctctggacgagaccttc
gatgccaagctagcgcagcccgagtccctcaattcgctgtttatcacgctgcacgatgag
atttttgagatccgagaactggcaatggtaaccattggacgactgtcctctatgaatccc
gcctatgtgatgcccaagctgaggaccaccatgatcgagctgctgacggatctaaaatat
tcggggatgaaccgcaacaaggagcagagcgcgaggatgttggaccatctggtgattagt
acgccccgtttgatatcctcgtacatgaatccgatactgaaggctctggtgccgaagcta
cacgagccggaatcgaatcctggcgtcatcctaaatgtacttcgcaccattggggatctg
gcggaggttaacggtggctccaatgaaatggaactgtgggccgatgacctgctctccatt
ctgctggaaatgctgggggatgccggctctcccgataagcggggcgtggccctgtggacg
ctgggacagctgatcagtgccacgggacgagtggtcagtccctaccacaagtatccggtg
ctcatcgacatcctcataaactttctgaagacggagcagcggcgctccatacgccgcgag
acgatccgcgtgctgggcctcctgggggccatggatccgtacaagcacaagatgaataag
ggtctaattgacagccaaaaggacaacgtactgatcgcctactccgatgggaaggtggac
gagagccaggacatatccacagccgagttactcgtgaatatgggcaatgccctggacgaa
tactatcccgcggtggccatagccgccctgatgcggatactgcgtgatcccaccctgagt
acccgccacacgagcgtcgtgcaggccgtgacgtttatcttccagagcctcgggatcaaa
tgtgtcccgtatttggctcaagtgctgcccaatctgctggacaatgtacgaacggcggac
aacaatctgcgagagtttctgttccagcagctggccattttggtggccttcgtgaagctg
cacatcatcagctacatgagcgacatcttcaagctgatcaaagagttctggaccatcaat
acgcccctgcagtccacgctgatcaatcttatagaacagattgccgtggccttgggctgc
gagtttcgggactatctggcagagctcataccacagatactgcgagtgctgcagcatgac
aactccaaggatcgaatggtcaccaggagattgctgcaggctttgcagaagtttggcagc
actttgggctactatctgccgctgattgtcccgcccatagtgaagctcttcgattcgccg
tatgtgccacagcaagtgtcgctggtggcccttgagacgatcaataatctggcctgccag
ctcgactttacggacttctcctccaggatcatacaccctttggtgcgagtgttggacaca
gagccagagctgcgcgaccaggccatgaccacactccggtctctggtcaagcagctgggc
aaaaagtatctcgtgttcgtgcccatggtgcagcgcatcctcacgaagcatcgcattggg
gatagcgagtacgacaagctgttgattcgcctgcagaacaacagcactctagcggatgcc
tgcggctcaggggagttcggtttgcggcaggccaagatcaagtacaacgagccctttgtc
acggacaggaacagcaataatcggaatctgcaggtctcgacgaatgtcctacgcactgcc
tggcaggtcacacgtcgtgtttcgaaggatgattgggtcgagtggctgaaacggctgtcc
attggcctgctcaaggaatccccctctcatgcgctgcgtgcctgctgctctctggcccag
gagtacgatacgctgctgagggacttgttcaatgccgccttcatctcctgctggacggaa
ctgtcgccggagcacaagcacgagctgacgcagtcgttgatccaggccctgcaggtcacc
gatatgccagagatcacccaaacaatccttaatctggccgagtttatggagcactgcgac
cgggatcccatacccattgagacgaatcttttgggcacccgagccatggcctgtcgcgcc
tatgccaaagccctgcgctacaaggaggaggagttcctgttaaaagaagaggcgtcggtc
tttgagtcgctgatcctcatcaacaacaaactgcagcaaagagaggcggccgagggtctt
ctgaccacataccggaatgcggccaacgagctgaatgtccagggacgctggtacgagaag
ctccacaactgggatcaggccttggagcactacgaacgcaatttacagacggattcatcg
gacctggaagcgcgtctggggcacatgcgctgcctggaggccctcggcgactggtcggag
ctgagtcaggtgaccaaacgcgagtgggagggcttcggcacagaggccagggcacgggcc
agccctctggctgcagtagccgcatggggtctgcaggactgggaggccatgcgggagtat
gtgcgctgtatacccgaggatacgcaggatgggagctactatcgggctgtcctggccgta
caccacgatgactttgagacggcccaaaggttgattgacgagaccagggatctgctggac
acagaactgacctccatggcgggagaatcctacgagcgagcttacggtgccatggtctgc
gtgcaaatgctggcggaactcgaagaagtcatccagtacaagctgatccccgagcgaagg
gaacccctgaagaccatgtggtggaagcgactgcagggaggacagcggctggtggaggat
tggcgccgcatcattcaggtgcattcgctggtggtgaagccccacgacgacatccacacg
tggctgaagtacgccagtctttgccggaagagcggttccctgcatctctcccacaagacg
ctggtgatgctgctaggcacggatcccaagctaaatccggacgaaaagctgccctgcaac
cagccgcaggtcacctttgcatataccaaatacatggccgcatcgaatcaactgcaggag
gcatacgaccagcttcggtgttttgtcgataagtacagcacggagctgagctgcctgccg
ccggaggctgtgaagccccaggatcagcgattgatggccaggtgctacttgcggctggcc
acctggcagaacaaactccaggagcgtctatgtccgggggccattcagggtgatctggag
tgctttgagaaggccaccagctacgacccgaactggtacaaggcctggcaccggtgggcc
tacatgaacttcaaggtggtgcaggcccagaagacggcgctggacaagcagcaagcatcg
ctgccgccgggactgaacatcggcattggcctgagcatggacagcgacatgttgatcatc
cagcagtatgcagtgcccgcggtgcagggcttcttccgttcgatcagcctgatcaagggg
aactccctacaggacacgctgcgactgctgacactctggtttgactatggcaaccatgcg
gaggtgtacgacgccctgatgtcgggcatgaagctgatcgagatcaacacctggctgcag
gtgataccccaactgattgcacgcatcgatacgcatcggcagttggtaggccaattgatc
caccagctgctcatggacattggcaagaatcatccgcaggccctggtctatccgctgacg
gtagcctccaaatccgcttcgctggcacgcaggaatgccgccttcaagatcttggactca
atgcggaaacactcacccacgctcgtggagcaggcggtgatgtgcagcgaggagctcatc
cgtgtggccatcctctggcacgagcagtggcacgagggtctggaagaggcctcccgcctg
tacttcggggatcgcaatgtaaaagggatgtttgagatcctagagccgctgcacgccatg
ctggagcgtggcccgcagacactcaaggagacctccttctcgcaggcctacggccgggaa
ctgacggaagcgtatgagtggtcgcagcgctacaagacctcggcggtggtgatggacttg
gaccgtgcctgggatatttattatcatgtgttccagaagatctcacgccaactgccgcag
ttgacgtcgctggagcttccgtatgtctcgcccaagctgatgacctgcaaggacctagag
ctggccgtccctggatcctacaaccctggccaggagttgatacgaatcagccacatcaag
acgaacctgcaggtgatcacgtccaagcagcgaccgcgcaagctctgcattcgcggatcc
aacggcaaggactacatgtacctgctgaagggccacgaggatctgcggcaggatgagcgt
gtaatgcagctattctcgctggtcaacaccctcttgctggacgacccggacacgttccgt
aggaatttggccattcagcgatacgctgtgatcccgctgagcaccaattcgggtctgatc
ggctgggtgccgcactgtgatacgctccacacgctgatacgcgactatcgggacaagaag
aaggtgccgctcaaccaggagcaccgcaccatgctgaactttgccccggactacgaccac
ttgacgctcatgcagaaggtggaggtgtttgagtacgctttagggcagacgcagggcgac
gatctggcaaagctgctgtggctcaagtccccctcctcggagctgtggttcgagcggcgc
aacaactatacccgatccctggccgtcatgtcgatggtgggttatatccttggcctgggc
gatcgccatccctccaacctcatgctggatcgcatgagcggcaagattctgcacattgac
tttggtgattgcttcgaggtggccatgacgcgggagaagttccccgagaagatacccttc
cgactcacgcggatgttgatcaaggccatggaggtgacgggcatcgagggaacgtaccga
cgcacctgcgagagcgtgatgctggtgctgcgacgcaacaaggactcgctgatggccgtg
ctggaggcgtttgtgtacgatccgctgctcaattggcgactcctcgatgtcgacaagaag
ggtaacgatgcggcgggtgccaatggcggcggtgccgccggtcgtggcggctctggcatg
caggtgggcaatagcggcgatagtttaagcaactctgtggaggattccctgcccatggcc
aagtcgaagacgtacgaggcgcagctgctgctgcagcaagccggtggcttgcacaacaac
gtggccgacgagacgaacagcaaggctagtcaggtgatcaagcgggtcaagtgcaagcta
acgggcacagatttccaaacgcagaagagcgtcaacgagcagcagcaggtggagctgctc
atccagcaggcgaccaacaacgagaacctctgccagtgctacattggctggtgtccgttc
tggtaa

DBGET integrated database retrieval system