KEGG   Drosophila persimilis: Dper_GL24851Help
Entry
Dper_GL24851      CDS       T01063                                 

Definition
GL24851 gene product from transcript GL24851-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpe00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 369 aa AA seqDB search
MVRVIEDMFGIAVNPMTQKTDQVRRFTLSTDRGMCVSIITLGAIIQRINVPDVDGKLEDV
CLGYDDVAGYYRNQPAYFGATIGRVANRVARGRFKLCGKEVSVSRNFRGQVSAPRAALWA
FDSVIWGCGGNTQRWRYLPSTSRRTATKGTPERLPVNINFSLNDTGCFGMRIEARAKATT
CVNITNHAYFNLAGHGSGRDTLLQHMLMIKAQKIVDTDLEQIPTGKLMRIRNTPYDFSSL
VNLGKRIGQLANCPIHGFDNNYCVDVPPNRVQLVARVVHPCSGRFMEVHTNQPGVQFYTA
NNLPDEDRGGAPNIGKAGAHYVRHGSFCLETQKYPDAMNHDDFPSIVLNPGQLYDHQVVY
RFGACPKRI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcgtgatcgaggatatgttcggcatcgctgtcaatcccatgactcaaaagacg
gatcaggtgcgtcgcttcacgctgagcacagaccggggtatgtgcgtgtccattatcact
ctgggggccatcatccagaggatcaatgtgccggacgttgacggaaagcttgaggatgtt
tgcctgggctacgatgacgttgctggctactaccgcaaccagccggcatactttggggcc
accattggaagggtggcgaatcgagtcgcccggggccgcttcaagctgtgcggcaaggaa
gtgagtgtgagccgcaacttcaggggacaagtatcagctccacgggcggctttgtgggct
ttcgacagcgttatctggggatgtggtgggaatacacaaagatggcgttaccttcccagc
acgtctcgccggacggccacgaagggtaccccggagaggttacccgtcaacatcaacttt
tcgctgaacgacacgggctgctttggcatgaggatcgaggcgagggccaaagccaccaca
tgcgttaatatcaccaaccatgcgtacttcaacctagccggccatgggagcggcagggat
accctcttgcagcacatgctgatgatcaaggcccagaagattgtggacacggacctcgag
cagattcccactgggaagctgatgcgcatccgcaacactccgtacgacttctccagcctt
gtcaacctcggcaagcgcattggacagctggccaactgtccgatccacggctttgataat
aactattgcgtcgacgtgccgcccaatcgtgtccagctggtggcccgcgttgtccatccc
tgcagcggtcgctttatggaagtgcacaccaaccagccaggggtacagttctataccgcc
aacaaccttcctgacgaggaccgcggcggggctccgaacattggcaaggccggggcccac
tatgtgcggcatggctccttctgcctggagacccaaaagtatcccgatgccatgaatcac
gatgacttcccatcgatcgtccttaatcctggacagttgtatgaccatcaggtggtctac
agattcggtgcctgccccaaacgaatttag

DBGET integrated database retrieval system