KEGG   Drosophila persimilis: Dper_GL24900Help
Entry
Dper_GL24900      CDS       T01063                                 

Definition
(RefSeq) GL24900 gene product from transcript GL24900-RA
  KO
K03350  anaphase-promoting complex subunit 3
Organism
dpe  Drosophila persimilis
Pathway
dpe04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dper_GL24900
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dper_GL24900
Ubiquitin system [BR:dpe04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dper_GL24900
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dper_GL24900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_8 TPR_2 ANAPC3 TPR_16 TPR_11 TPR_12 TPR_17 TPR_14 TPR_19 TPR_9 TPR_7 TPR_20
Motif
Other DBs
NCBI-GeneID: 6596114
NCBI-ProteinID: XP_002021267
FlyBase: FBgn0162487
UniProt: B4GRN8
AA seq 932 aa AA seqDB search
MMIQEPVQAAIWHCMNYYDHKDAVFLAERLCSEVECDETIFLLATSYFRSNLVHQAYWLL
KEKARRSAQCRFLQAKCAYELKKFAEAESALINTGFADAKNFDELQRDFGELACFAYQLI
AQICIKTERNKLAATALRRALKLNPFMWHAFADLCLLGQDMDTASIFQIQSTDVFNTCQG
SSANATSMVLFGNEQQQHQQQQVQQTALENVLTKISNISNYVWTTPVDHHQAQQQQQQNQ
NQHQLGINNNSSNLMTPINNNNINNNLNSSMSMLRGGGVAQNSSMLAMLEDTPMGCPQET
GQPQPQQQQSQLYDVSSVTPFRKQFKYLSTISPTTPSFGVWPLTSPCSGSDGSFVGGGSV
VSGNGTHTPVMNITYSPMTQMLVEVNQEPKMMGKKLKTHVGGLISRKDTSSNSNKPAVFT
QAGNITPRTPNNNVGNGNNLNVPPNPNAAVRRSSRLFSNSAYSVKENNKSPNIANNKFVQ
PRSPPRKTKSRMTKICLNNELIEEKTSHLSDKLSDKQARKEKVETITSAANNNNNRSAAE
EAKVLLNNNLNNAQTMAHQLLSLKKQSADGLMSLLRDLAEAYKLISMFQCKSAIKQLETT
IPKHHLNSSWVQSLIGLCRYEMRDYEAAVVLFEAIHKAEPCRLDYMEIYSTSLWHLQKEV
ELSSLAQDLISQNKSSPVTWCVSGNCFSLHKEHETAIKFFKRAVQVDPDFVYSYTLLGHE
LVLTEEFDKAMDYFRAAVVRDPRHYNAWFGIGTIYSKQEKYELAEIHYMKALKINPQNSV
ILVHIGTIQFYMKKKDLSLQTLNTAATLDPKNPLARFHRGSIYHSLGKYQEALRELEELK
EIVPKESVVFYLIGKIHKTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPSCCTA
NTTALDVDLEPNSERSDDSTQAQQDVSYDSDY
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaggagcctgttcaggcagccatatggcattgcatgaactactacgaccac
aaagatgctgtttttttggcggagcgcctgtgctctgaagtggaatgcgacgagacgata
tttctactggccaccagctactttcgctccaatctcgtgcaccaggcctattggctgctc
aaggagaaggcgcgccgctcggcccagtgccgcttcctacaggccaagtgcgcctacgag
ttgaagaagtttgccgaggccgagagcgccctgataaacactggatttgcggacgcgaaa
aacttcgacgagctgcagcgtgactttggagaattggcttgctttgcctaccagctgata
gcacaaatctgcataaagaccgagcgcaacaagctggccgcaactgctctgaggcgggct
ctgaagctgaaccccttcatgtggcatgccttcgcggatctgtgcctgctgggccaggac
atggacactgcgtcaatattccaaatccaaagcacggatgtgttcaacacctgccaaggc
agcagcgccaatgctacttccatggtgctattcggcaacgagcagcaacaacaccagcag
cagcaggtgcagcaaacggctcttgagaatgtactcacgaagataagcaatatctccaat
tacgtttggaccacaccggtggatcatcaccaggcacagcagcagcaacaacagaatcag
aaccagcatcagcttgggataaacaacaacagtagcaacctgatgacgcccattaacaat
aacaacatcaacaacaatctcaacagctccatgagcatgcttcgaggcggaggagtcgcc
cagaactccagcatgctggcgatgctggaggatacgcccatgggctgtccccaagagacg
ggccagccgcagccgcagcagcagcaaagtcaattgtacgacgtcagcagtgtcactccg
ttccgtaaacaattcaaatacctatccaccatctcgcccaccactcccagcttcggggtt
tggcccttgactagtccctgttctgggagcgatggctcattcgtcggtggcggtagcgtt
gtcagcggcaacggaacccacactccagtcatgaatatcacgtactcccccatgacccaa
atgctcgtcgaggtcaaccaggagcccaagatgatgggcaaaaagctaaagacacatgtg
gggggactgataagccgcaaggacaccagcagcaacagcaacaagcccgccgttttcacc
caagccggcaatataacgccgcgaacacccaacaataatgtgggcaacggcaataatctt
aatgtgccgcccaatcccaacgccgctgtgcgccgcagctcgcgcctgttcagcaattcc
gcctactctgtaaaagagaacaacaagtcgcccaacatagccaacaataagtttgtgcag
ccacgctcgccgcccaggaagaccaagtcccgcatgacgaagatctgcctaaacaacgag
ctgattgaggagaagaccagccacttgtcggacaagttgagcgacaagcaggcgcgcaag
gagaaggtcgagacgattacgtcggcagccaacaacaacaataaccgcagtgccgccgaa
gaggccaaggtgctgctcaacaacaacctgaacaatgcccagaccatggcccatcagctg
ctaagtctaaagaagcagtcggccgacggtctcatgtcgctgctccgcgacttggccgag
gcctataagctgatctcgatgtttcagtgcaagtcggccatcaagcagctagagacaacg
ataccaaagcatcatttgaattccagttgggtgcagtccctgattggcctgtgcagatac
gagatgagggactacgaagcggcggtggtgctcttcgaggccatacacaaggcggagccg
tgtcgcctagactacatggagatatactcaacatccctatggcatttacaaaaggaagta
gagctgtcctcgctggcccaggacctcatcagtcagaacaagagcagtccagtgacctgg
tgtgtgtccggcaactgtttctccctgcataaggagcacgagacggccatcaaattcttc
aagcgagccgtccaggtggatcccgacttcgtctacagctacaccctgctgggccacgag
ctggtgctcaccgaggagtttgacaaggccatggactacttccgagcggccgtcgtgcgc
gatcccagacactacaatgcctggtttggtattggcaccatctactccaagcaggagaag
tacgaactggccgagatccactacatgaaggccttgaaaatcaatccgcagaactctgtg
atcctggtccacatcgggacaattcagttctacatgaagaagaaggacctgtcgctgcag
accctcaacacggctgccacactggatccaaagaatccgctggcgcgattccatcggggc
tcgatataccactcgctgggaaagtaccaggaggccctgcgtgagctggaggagctcaag
gagattgtgccaaaggaatctgtggtcttctatctcattggcaaaatacacaagactctc
ggcaacatggatctggcactgatgcacttcagctgggccaccgatctcgatcccaagggg
gccaacaatcaaatcaaagatgccttcgactcaatggcccaccccagctgctgtacggcc
aacacgactgccctcgatgtcgatctcgagcccaattccgagcgatccgatgactcgacg
caggctcagcaggatgttagctacgacagtgactactaa

DBGET integrated database retrieval system