KEGG   Drosophila persimilis: Dper_GL24945Help
Entry
Dper_GL24945      CDS       T01063                                 

Definition
GL24945 gene product from transcript GL24945-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dpe  Drosophila persimilis
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dper_GL24945
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dper_GL24945
Transcription machinery [BR:dpe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dper_GL24945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 786 aa AA seqDB search
MSGGPSVTLKSQPIDGSNSGNAAAQQQQQSANGAASSANQGQGSNTNGSAGVSGGAPAQE
GTRQNSLQRIQQRKQKVFNLPLPQKVAKLSMYSACQAEGCRCTGWKTPQENRHRDVESSY
CPEFNEECRNSSCRHSLRTHIAHLDNITSSSMDELLGAIIDMENLFMSMQRVEDEDTKKV
YLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFYKYQHLNPTELQTMTEV
AKTFLNFLNHYNFESPSTRRGELAHEDASNYKINYTRWLVFCHVPAFCNSLRQFETSLVF
GRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKDDSPIWDPN
YRPPNSFVIQQRKRNQEAAAPPAPGGGAAAIGSNKRSSVGEPLHKRPKKETLERPISENL
DDLPTDVVMRAMKSVSESKTTNKSEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPV
DKQTILWLFGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKESQPIGGICFRPFPSQG
FTEIVFCAVTMAEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIK
LARPVYAGYIKEYDSATLMHCELHPTIVNTQFIAVIRNQSEILKELIAQRHNEVQKVRAG
LTCFKEGVRSIPVESIPGLMEIGWKPQMRPARSARPLEESSDPEKLATSFASVLQSVRQH
TTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFY
NSPEPK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccctcagtaacgctaaaaagtcaaccaattgatgggagtaacagcgga
aatgctgcagcgcaacagcagcagcaatctgcgaatggcgcagcgtcttcagcgaaccag
ggccaaggcagcaacaccaatggtagcgctggggtaagcggcggtgcgcccgcacaagag
ggcacccgccagaacagcttgcagcgcatccagcagcgaaagcaaaaggtattcaacctg
cccctgccccagaaggtggccaagctgtcgatgtactcggcctgccaggctgaaggctgc
cgttgcaccggatggaaaacacctcaggagaacaggcatcgtgatgtggagtcgtcttac
tgtccagaattcaacgaggaatgtcgcaactccagctgccgtcattccctgcgaacgcac
atcgcccacttggacaatataaccagctccagcatggacgagcttctgggtgccattatt
gatatggaaaatctgttcatgtccatgcagcgagtggaagatgaggataccaaaaaggta
tatttgtatctgttccgcctgttgcgtcagtgcgtcctgacgcgccagcaagctgtcatt
cgtggccctttgggtgatcccccgttcgagtcgccatgcattacaaaggcagttttgtcc
ctggtcttctacaaataccagcaccttaacccgactgagctacaaacaatgactgaggtg
gcaaaaacgtttttaaactttctcaaccactacaatttcgagtcgccttcaacgaggcgc
ggcgaactagcccatgaggatgcgtccaactataagatcaactatacccgctggcttgtc
ttctgtcatgttcctgctttttgcaattctttgcgccagttcgagacctcgctggtgttc
ggacgcacccttctgcgcaccgtgttccagtacatgtcgcagcagctaaagaagaagtgc
atttcggaacgagatcgctttccggaagacaagcggtccattataacgcaaatgccaaag
tttcttgaggcgctgcgagcagagcttttgaaagatgactcccccatatgggatcccaac
tatcgtccacccaattcatttgtcatccagcaacggaagcgcaatcaggaagcggcggca
ccaccagcacctggtggcggtgcagctgctattggcagcaataaacgctcaagcgtgggg
gaaccacttcacaagagacccaaaaaggaaacgctcgagcgccccatcagtgagaacttg
gacgatcttcctacagatgtggtaatgcgtgccatgaaatcggtctccgagtcgaaaaca
acaaacaagtcggaaattctcttcccggtcaatgtgtcacgggatgagaacgtcaaggcc
gaggagcagaagcgcgccattgagttccatgtggtgggcaactccctaacgaagccagtg
gataagcagacaatcctgtggctcttcggtctgcagcttgtctttgcctaccaacttccc
gaaatgccccgcgagtatataagccagctagtgtttgacacaaagcacaaaacccttgcc
ctcatcaaggaaagccagccaatcgggggcatatgcttccgtccgtttccatcgcaggga
ttcacagaaatcgtgttctgtgccgtcaccatggcggagcaggttaagggttatggcacc
catttgatgaaccatctgaaggattacagtattcagcgcggtattaagcatctgctcaca
tttgccgattgcgatgccatcggatattttaagaagcaaggattctccaaggacattaag
ctggctcgtcccgtctatgccggctatataaaggaatacgatagcgccactttgatgcac
tgcgagctgcatccaaccattgtaaacacgcagtttattgcggtgatcagaaatcaaagc
gaaattctgaaagagctcattgctcagcgacacaatgaagtgcagaaagttagagctggt
ttaacttgctttaaggaaggggttcggtctataccggtcgagtccattcctggcctcatg
gaaatcggttggaagccacaaatgcgcccagctcgatcggcccgacccttggaggaatcg
tcggatccagagaaactggccacatcattcgcgtctgtccttcaatcagtccgacagcac
accacggcatggccctttttgcgtccagtgactgctgcggaagtgcccgactattacgac
cacattaagtatcccatggacttgaagacgatgggcgaacgtttaaagaagggttactat
caaacacgtcgccttttcatggcagacatggcacgcattttctcaaactgtcgcttttac
aactcccccgaaccgaaataa

DBGET integrated database retrieval system