KEGG   Drosophila persimilis: Dper_GL25135Help
Entry
Dper_GL25135      CDS       T01063                                 

Definition
(RefSeq) GL25135 gene product from transcript GL25135-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6595985
NCBI-ProteinID: XP_002021051
FlyBase: FBgn0162722
UniProt: B4GR22
AA seq 359 aa AA seqDB search
MTATDGRSTPNWWEAVPRVLTDIVTVKANILTAAPLELAANAIDMLCSSTLFMGRVPPKI
TPDINKMHFQYMTPCHNYSVPLLDAAKLWNHSKFGKGRKVVILATGWTNTVNESSAIAMI
SRAFMCRRDVNFVIVDAADYVDTLYSWSALNTDLIGEHIAVGLTHLIELTPLRNIHLIGH
SLGAHIMGTAGRTFKRLTGRLVPRITGLDPAKPCFRQEDILPGLTRGDAQLVDVIHTNIG
ILAKRGPLGDVDFYPGGAHPIQPGCLTIGCSHTRAVEYFAESAYPQQEKNFMGTKCSSWD
ELRRRDCRAGAGTPSSMGYIIDRKARGIYYVDVNGWPPYGRSSSKTANPRSKICHLCRT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaactgatggcagatctacaccaaattggtgggaggcagtgcccagagtcctg
accgacattgtgacagtgaaagcgaatatcctcacggctgctcctctcgagctggcagcc
aatgcgatagatatgctgtgctcttccacgctgtttatgggcagagtaccgccgaagatc
actccagatataaataaaatgcactttcagtacatgacgccctgccacaactacagtgtt
ccactgctggatgcagcgaagctctggaatcactccaagtttggcaagggtcgcaaggtg
gtcatcttggcgaccggctggacaaacactgtcaacgaatcctccgccatcgccatgatt
tcgagggccttcatgtgtcgccgcgatgtgaactttgttattgttgacgctgccgattac
gtggacacactgtactcttggtcggccctaaacacggaccttattggcgagcacattgct
gttggtctaacgcatttgatagagctcactcccctgcgaaatatccacttgatcggacat
tcgttgggggcacacattatgggtactgctgggcgcacatttaagcggcttactggccga
ctggtaccccgtataacaggtctggaccccgcgaaaccctgttttcggcaggaagacatt
ctgccgggactgacccggggagatgcgcagctggtggacgtcatccataccaacattggt
attctggcgaagcgtgggcccctgggcgatgtagatttctatccgggtggagcacatccc
atacagcccggttgcctgaccatcggctgctctcatacacgcgccgtagagtactttgca
gagagtgcatatccccaacaggagaagaactttatgggcaccaaatgcagttcttgggat
gagctccgacgacgcgactgcagggcgggcgcgggcacaccttcctcgatgggatacata
attgacagaaaagcgagaggcatctattacgtagatgtgaatggatggcccccgtatggt
cggagtagtagtaagactgcaaatcccagatcaaagatttgccacctttgccggacatga

DBGET integrated database retrieval system