KEGG   Drosophila persimilis: Dper_GL25529Help
Entry
Dper_GL25529      CDS       T01063                                 

Definition
GL25529 gene product from transcript GL25529-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dpe  Drosophila persimilis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dpe03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dpe03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MADTKSGRYASAGSSNSVVPLVQGPANLECKDFQEYLRTRQTAETLEKLYNYPPICLAVF
RELPELARQFIIRILFVDQPVPQAVVTSWGAQRFAKEQTEATSCLSDLNVWRVTAIPGGL
SAWELSPTFKKSVRQVLLGGGKPWPMTNTLEKDSKPRDIAFLDSYAMSRWRCVLHYMVGT
GNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLD
TCEERGVSLPECLSMLFQLSFSTLGRDYSSEGMNSQMLSFLQHLREFGLVFQRKRKEGRF
YPTRLALNVTSKEAATTMTVSDEEAMQDSGYIVVETNYRVYAYTDSPLQVAVLGLFTELL
YRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLQQYAHPNMKLVESAIQSKSCLPPTVVD
QIKLWEMERNRFTYTEGVVYNQFLSQNDFVTLRDYAQSIHVLVWQNERTRTMVVQKHGHD
DVKRYWKKYSKGGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacaaaatctgggagatatgccagtgccggcagcagcaatagtgttgtgccc
cttgtgcaggggccggcgaatctggagtgcaaggacttccaggagtatcttcgcactcgc
cagactgccgagacgctggagaaactatacaattatccgccgatttgcctagccgtgttc
cgggagctgcccgaactagccagacagttcattatacgaattttattcgtggatcagccg
gtgccacaggctgtggtcacctcctggggggcccagcgatttgccaaggagcaaaccgag
gccaccagctgcctctcggatctaaatgtttggcgtgtgacggccataccaggcggcctg
tctgcatgggagctgtcacccacattcaagaaaagcgttcgccaggttcttttgggcggc
ggcaagccgtggccgatgaccaatacactggagaaagactcgaagccacgtgacatagcc
ttcctggactcctatgccatgtcgcgctggcgctgtgtgcttcattacatggtgggaacg
ggaaaccgtaatggcaccgatgcagaagcgatcagtccggatgctgtgaggattctactc
catgcaaatctcatgaagcgcgacgagcgagacggaattacaatcacccgccaagggttt
cagttcctgctgctggacacacgtgcacaggtctggcatttcatgctccagtatttggat
acatgcgaagagcggggagtatctcttccggagtgtctttccatgctgttccagctcagt
ttctccaccctcggtcgagactacagctcagagggcatgaacagccagatgttgtccttc
ctgcagcatttgcgcgagtttggtttggttttccagcggaaacgcaaggagggccggttt
tatcccactcgtcttgccctaaacgtgaccagcaaggaagcggctaccacaatgacagtg
tcagacgaggaggccatgcaggacagtggctacattgtggtagagacaaactatcgcgtc
tatgcctacacggattctcctcttcaagtggcggtcctgggcctgtttaccgagttgctc
tatcgctttcccaacttggtcgtgggcgtgctcacccgcgactctgtgcgtcaggcatta
cgcggcggcatcaccgcagaacagattgtctcctatctgcagcagtacgcccaccccaac
atgaaactagtggagtcggccatccaatcaaagtcctgcctgccgcccaccgttgtggat
caaatcaagctctgggagatggagcgcaaccggtttacatacacggagggagtggtctac
aatcagtttctctcccagaacgatttcgtcactctgcgcgactatgcgcagtcgatccat
gtcttggtttggcagaatgagcgcactcgcaccatggtggtgcagaagcatggtcacgac
gatgtcaagcgctattggaagaagtattcgaagggtggcggttag

DBGET integrated database retrieval system