KEGG   Drosophila persimilis: Dper_GL25710Help
Entry
Dper_GL25710      CDS       T01063                                 

Definition
GL25710 gene product from transcript GL25710-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 510 aa AA seqDB search
MWISGQLVLLLLVALVAAKTKTSAVQEDVSEYKDFKKLLRTKNNVLALYVTSAKAAGTEL
RVFREAAEAIRGTGTMLLVDCGQQDRKKLCKKLKISPDRYTLKHYKDGDYHKDYDRQVSV
GSIVTFMRDPSGDLPWEEDADGNDVLHFSDAATFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKAATELKSQGGYLLAAMNVERQENAPVRRLFNITGFPTLIYFENGKLRFTYEGEN
TKDALVAFMLNPNTKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKEEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQQKVLGLLAALDATKEQPIAEKYKVKGYPTVKYFANGVYKFD
VNVREASKIVDFMRDPREPPPPPPPEKSWEEEGDSKEVLFLNDETFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRVAFAAIDCTKHSALCAKYNVRGYPTILYFSYLK
IKLDYNGGRTSKDFIAYVNNPPSTTDHTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatctcaggccagctagtattgctccttctggtggcacttgttgccgctaaaacg
aaaacttctgctgtgcaggaggacgtgtccgaatacaaggactttaagaaactactgcgc
accaagaacaatgtcctggccctctatgtgaccagtgccaaggcggcgggcaccgaactg
agggtgttccgtgaggctgcagaggcgatacgaggcaccggtaccatgctgttggtggat
tgtggacagcaggataggaagaaattgtgtaaaaagctgaaaatctcaccggaccggtat
acgctcaagcactacaaagatggcgactatcacaaggattacgatcgacaggtgagtgtc
ggttccattgtcacgtttatgcgtgatccgtccggtgatctgccctgggaagaggatgct
gacggcaacgatgtgctgcacttcagtgatgctgccacattcacgaaacacctgcgcaag
gacatacgtcccatgctggttatgttctatgtgccctggtgtggcttttgcaagaaaatg
aagccggactacggcaaggcggccacagagctcaagtcccagggtggctatctgctggca
gccatgaatgtggaacgccaggagaatgcccccgtgcgcagactttttaacataacagga
ttccccacactgatctactttgagaacggcaagcttcgctttacctacgagggtgagaac
accaaggatgccttggtggcgttcatgctaaatcccaacacaaagcccacgcccaagccc
aaggaacccgaatggtcagcggataccaactcggaaatagttcatctcaccagccagggc
tttgagcccgcattgaaagaagagaagtccgccttagttatgttctatgcaccctggtgc
ggccactgcaagcgcatgaagcccgagtatgaaaaggcagcgctggagatgaagcagcaa
aaggtgctcggtttattggccgcgttggatgccaccaaagagcaaccgattgccgagaag
tacaaggtcaagggatacccaacggtcaagtactttgcgaatggcgtctacaagtttgat
gtcaatgtgcgggaagcatcgaaaatagttgattttatgcgggatcccagggagccgccg
ccgccaccaccgccggagaagagctgggaggaggaaggtgatagcaaagaggtgctcttt
ctcaatgacgagaccttcagctcgacgctaaagcgcaagaagcatgcgctggtcatgttc
tacgccccttggtgtggacactgtaagcacactaagccagagtttacagcggccgccaca
gcgctgcaggacgatccacgcgttgcatttgccgccattgactgtaccaagcattccgca
ctctgtgccaaatacaatgtccgtggatatccaactattttgtatttctcctacctcaag
atcaagctagactacaatggtggacgcaccagcaaggactttattgcctacgtgaacaat
ccgccgagcacaacggaccacaccgagctgtga

DBGET integrated database retrieval system