KEGG   Drosophila persimilis: Dper_GL25779Help
Entry
Dper_GL25779      CDS       T01063                                 

Definition
GL25779 gene product from transcript GL25779-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dpe  Drosophila persimilis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dpe04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 493 aa AA seqDB search
MKFLICTLLAAAFYVAAAEVKVEEGVLIATVDNFKQLVADNEFVLVEFYAPWCGHCKALA
PEYAKAAQQLAEKDSPIKLAKVDATVEGELAEQYQVRGYPTLKFFRSGAPVEYSGGRQAA
DIISWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDTDSEEAKTFTKAANALDSFV
FGVSSNADIIAKYEAKDNGVILFKPFDGKKSVFEGELTEETLKKFAQVQSLPLIVDFNHE
SASKIFGGSIKSHLLFFVSKEAGHIEAHVDPLKEIAKKYRDDILFVTISSDEEDHTRIFE
FFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQDLPED
WDKQPVKVLVSRNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNTDIVIA
KMDSTANELENIKISSFPTIKYFRKDDNKVIDYNLDRTLDDFIKFLDANGEVADAEPAEE
TEEEEEAPKKDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctaatctgtacactactcgccgcggctttctacgtggccgctgccgaagtc
aaagttgaggagggggttctcattgcgacagtggacaactttaagcaattggttgccgac
aatgaatttgtgctagttgagttctatgctccctggtgcggacactgcaaggccctcgct
cccgagtatgccaaggctgctcagcagctggccgagaaggattcaccaatcaagctggcc
aaggtcgacgccaccgtcgaaggtgagctagctgagcagtaccaggtgcgtggttatccc
acactcaagttcttccggagcggtgctccagtggagtacagcgggggtcgtcaggccgcc
gacatcatctcttgggtaaccaagaagactggaccacctgccaaggatctgaccagcgtg
gccgatgctgagcagttcctcaaggacaacgaaattgccatcattggtttcttcaaggat
accgactctgaggaggccaagaccttcaccaaggccgccaacgccctggactcgtttgtc
ttcggagtgagcagcaatgccgatattattgccaagtacgaggccaaggacaatggcgtg
atcctgttcaagcccttcgatggcaagaaatctgtgttcgaaggcgagctcaccgaggag
actctgaagaagttcgctcaagtacagtctctgcccctgattgtggacttcaaccacgag
tcggcttcaaagatcttcggaggctccatcaaatcccacctgttgttcttcgtctccaag
gaggccggacacattgaggcccatgtcgatccccttaaggagattgctaagaagtaccgc
gatgatattctgttcgttacgatctcgtctgatgaggaggaccatacccgcatctttgag
ttcttcggtatgaacaaggaggaggtgccaaccatccgtctgatcaaactggaggaggac
atggccaagtacaagccagagtcgaacgatctgtctgccgagaccattgaagctttcctg
aagaagttcctcgacggaaaactgaagcagcacttgctgtcccaggatctgcccgaggat
tgggataaacagcccgtcaaggtccttgtctccaggaacttcgagagcgtcgccctcgac
aagagcaagtccgtcctggttgagttctatgctccatggtgcggccactgcaagcagctg
gcacccatatatgaccagctggccgagaagtacaaggacaacaccgacattgtgattgcc
aagatggactctactgccaacgagctggagaacattaaaatctcatccttccccacaatc
aagtacttccgtaaggatgacaacaaggtcatcgactacaacttggatagaactctggac
gatttcatcaagttcctcgatgccaacggtgaggtggccgatgccgagcccgcagaggag
accgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system