KEGG   Drosophila persimilis: Dper_GL25955Help
Entry
Dper_GL25955      CDS       T01063                                 

Definition
GL25955 gene product from transcript GL25955-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dpe  Drosophila persimilis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dper_GL25955
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dper_GL25955
    2.7.1.82  ethanolamine kinase
     Dper_GL25955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 558 aa AA seqDB search
MRQRICGNNKTLKRRQEQQQEIVENCCLSKRCKYDNIWQHFKRNATLEEIRHAAARICRD
YLTGRWKVVTPESLVVKRISGGLSNFLYYVSLPDSDADENENEEQGLLEQQANGHVAKDN
VIFVDAGATNIVSKNSPDFARNGVEVESESVGGAADDDDAATSAKQAHKRQRFDSDSGDS
SSLKRLHAPKQEPREVLLRIYGQTHGDHALESMITESVVFALLSERNFGPKLHGIFPGGR
IEQYLPARALATAELAEQRILLKVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVTSFESIV
KGKIQSKPDSAVLQKQRELMRTIDYVQEIAWLRSVIESGEYPVVFCHNDLQEGNILLRQA
TPERTPRESISSLRSNFDETLGDSLDGNSNLSEPEVNKSHSSSSSCPELLDTTDDSALDT
SFTNDNEPDLIIIDFEYCAYNYRGYDLANHFIEWTFDYTNPQFPYFHHNTSNYATAQQRR
DFIVNYLKKYHDDENYNPTVQELENVDSEIQFFTMMSHLFWSLWSVINVTSAIEFGYWEY
GIARILEYQKLKAAFLAK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcgaatttgtggcaacaataaaacactaaaacgtcgccaagagcagcagcag
gaaattgttgaaaactgttgtctaagtaaacgttgtaaatatgataatatttggcagcat
tttaagcgaaatgcaacccttgaggaaattcgccatgcggcagcacgcatctgtcgggac
tatctaaccggtcgctggaaggtcgtaacccccgaatctttggtggtgaaacgcatcagt
ggcggtctttcaaactttttgtattacgtgagtctgcccgattcggatgcggatgagaat
gagaacgaagagcagggactgttggagcagcaggcgaatggccatgttgccaaagacaac
gtcatatttgtcgatgccggcgccacaaatatcgtgtccaaaaatagcccagactttgca
cgcaatggggtggaggtggagtccgagtccgtgggtggggcggcagacgatgacgacgca
gccacgagcgccaagcaggcgcacaaacgtcagcgattcgatagcgatagcggcgattcg
agttcattgaaacgattgcatgcccccaagcaggaaccccgtgaggtcctgctgcgtatc
tatggccaaacccatggagatcatgcgctggagagcatgattaccgaatcggttgtgttt
gcactgctcagtgagcgtaattttggacccaaactgcatggcatctttcccggcggacgc
atcgagcaatacttaccggcacgtgccttggccacagcggagttggccgaacagcgtatc
ctactgaaagtggcagagaaaatgggtgaaatccacagcctgaatatacccatgtccaag
gaacccgattggatctggaattgcatgcagcgttgggtgaccagcttcgagagcattgtc
aagggcaaaatccaatcgaaaccggactccgcagtgctccagaagcaaagggaactgatg
cgcaccatcgactatgtccaggagatagcatggctgagatcggtgatcgagagcggggaa
tatcccgtggtgttctgccacaacgacctgcaggagggaaatatactgttgcgtcaggcg
acaccagagcgtacgcctcgtgaatccatcagtagcttgagatccaatttcgatgagaca
ttgggcgacagtttggatggcaacagcaatctgtcggagccagaagtcaacaaatcgcac
agctcgtcctcgtcctgtcccgaactgttggacaccaccgatgattcagccctggacacc
agcttcaccaacgataatgagccggatcttattatcattgactttgagtactgtgcctat
aactatcgtggctacgatctggccaatcacttcatcgaatggacctttgactataccaat
ccgcagttcccatattttcatcacaatacaagcaactatgccaccgcccagcagagacgc
gatttcattgtgaattatctaaagaaatatcacgatgatgagaactataatcccacggta
caagagctggagaatgtggactccgagatacagttctttacgatgatgtcgcatctgttc
tggagcctgtggtcggtgattaatgtgacatcagccatagagtttggttattgggagtac
ggcattgctcgaattctggaatatcaaaagctaaaggccgcctttctggccaaatga

DBGET integrated database retrieval system