KEGG   Drosophila persimilis: Dper_GL25993Help
Entry
Dper_GL25993      CDS       T01063                                 

Gene name
Dper_Adh
Definition
Alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dpe01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpe00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dpe00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dpe00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dpe00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dpe00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dpe00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 254 aa AA seqDB search
MSLTNKNVVFVAGLGGIGLDTSRELVKRNLKNLVILDRIDNPAAIAELKAINPKVTITFY
PYDVTVPVAETTKLLKTIFAQVKTIDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILD
FWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVN
PGITRTTLVHKFNSWLDVEPRVAEKLLEHPTQTSQQCAENFVKAIELNKNGAIWKLDLGT
LEPITWTQHWDSGI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaccaacaagaacgtcgttttcgtggccggtctgggcggcattggcctggac
accagccgggagttggtcaagcgtaatctgaagaacctggtcatcctggatcgcattgac
aatccggctgccattgccgaactgaaggcaatcaatcccaaggtgaccatcaccttctat
ccctacgatgtgactgtgcccgtcgctgagaccaccaagctcctgaagaccatctttgcc
caggtgaagacaatcgatgtcctgatcaacggtgctggcatcctggacgatcatcagatc
gagcgcaccattgccgttaactacacgggcctggtcaacaccaccacagccattctggac
ttctgggacaagcgcaagggcggcccaggcggcatcatttgcaacattggctccgtcacc
ggtttcaatgccatctaccaggtgcccgtttactccggctccaaggcggcggtggttaac
tttacctcctccctggcgaaactggctcccattactggtgtcactgcttacactgtcaat
cctggcatcaccaggaccactctggtccacaaattcaactcgtggctggatgtggagccc
cgtgtggcggagaagctgctcgagcatcccacccagacctctcagcagtgcgccgagaac
tttgtgaaggccattgagctgaacaagaacggtgccatctggaagttggatttgggcacc
ttggagcccatcacatggacccagcactgggactcgggcatctaa

DBGET integrated database retrieval system