KEGG   Drosophila persimilis: Dper_GL26186Help
Entry
Dper_GL26186      CDS       T01063                                 

Definition
GL26186 gene product from transcript GL26186-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dpe  Drosophila persimilis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dper_GL26186
   00330 Arginine and proline metabolism
    Dper_GL26186
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dper_GL26186
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dper_GL26186
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dper_GL26186
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dper_GL26186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHYQKEGNGIPVKVTIISEEFSPNTTGDGSAGLWGPYLL
GGTEKSKVYKWSKNMHSFLEQIWLSEDAGEAGVCLVPCIRLSTSTVDTVEDFWRDIVYGA
LDLTAEQLAVYNQGRSVKFTSGLSFVTYTSEPVKLLPYLMKRFARNGGAVVQQKVTDLER
FITESPYDVIVNCSGLGSRELLNDDQMYAVRGQVSRVKANWMFSAVLDESDDGNYIIPNT
ESVVLGGTHQERDYNTRVCEKDKKLIVDGCRQFVPGLCHTKPLFDWVGLRPGRANLRLEA
ERRGQKLLIHNYGHGGSGVTLCWGCADDVLDLLLAAKNISKL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacatcgctgttatcggggctggcgtcaacggtgtcgccagtgccataaagatc
ttggagcactaccagaaggagggtaacggcatccctgtgaaggtgacgatcatctcggag
gaattctcgccaaacaccacaggagatggctcggcgggtctttggggcccttatctgctg
ggtggcacggaaaaatctaaagtctacaagtggtcgaagaatatgcatagttttctggag
cagatctggctaagcgaggatgccggcgaggctggtgtttgtctcgtgccctgcatccgt
ctgagcacatccacagtggatactgtcgaggatttctggcgtgacattgtttatggggct
ctggacctaaccgctgaacagcttgcagtctacaatcaaggcagatcggtgaagtttaca
tctggcctgtcctttgtcacatacacctcagagcccgtgaaactactgccgtatctcatg
aagcgtttcgctcggaacggaggtgcagtagtgcagcaaaaggtcacagatctggagaga
ttcatcactgaatcgccctacgatgtgattgtcaactgttcgggtctgggctcccgcgaa
ttgctcaacgatgatcagatgtatgccgtgcgcggtcaggtttcccgagtgaaagccaat
tggatgttctcagccgtactggatgagagcgatgatggcaactatataatacccaacact
gagagtgtcgtactgggcggcacccaccaggagagggactacaacaccagggtctgcgag
aaggacaagaaacttattgtggacggctgtcgtcagtttgttccgggcctgtgccacacc
aagccgctgttcgattgggttggccttcgcccaggacgtgcaaatttgcgcctcgaggcc
gagcggcgtggccagaagctgctcatccacaactatggacacggcggcagtggggtgacg
ctgtgctggggctgtgccgatgatgttctcgatctcctgctggctgccaagaatatttca
aagttgtaa

DBGET integrated database retrieval system