KEGG   Drosophila persimilis: Dper_GL26283Help
Entry
Dper_GL26283      CDS       T01063                                 

Definition
(RefSeq) GL26283 gene product from transcript GL26283-RA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dpe  Drosophila persimilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dper_GL26283
   00053 Ascorbate and aldarate metabolism
    Dper_GL26283
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dper_GL26283
   00860 Porphyrin and chlorophyll metabolism
    Dper_GL26283
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL26283
   00982 Drug metabolism - cytochrome P450
    Dper_GL26283
   00983 Drug metabolism - other enzymes
    Dper_GL26283
Enzymes [BR:dpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dper_GL26283
Glycosyltransferases [BR:dpe01003]
 Others
  Hydrophobic molecule
   Dper_GL26283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 527 aa AA seqDB search
MVRILLLAVAAVALIGGGQGANILGLFTSLSPSHLIIQMSAAKALAERGHNVTVVTVLEP
AITHKDINLIQVPLSEEDTEHMSRVFEKMGKNNDKNMLFAMFRMFGHMRFMFHKIADALK
DTRVRDLYVNKDNRFDLVLSGFALNDYQMGFAQKLKAPVIVVATLPPSPLFNYLIGNPEE
PSCVPSINDSVEKGKGLSFGQRLSSYLTGIGYKVFSKMGEIQNKKAYKEVFGDDPHMPEY
SEMMKNVSLVFFASHAISEGPIRPNVPGVIEIGGIQIKDTPTPLPPNIEEFVGNATDGAI
LLSLGSNVQGSHLSPDTVQKMFNVLSKLKQRVIWKWEDLDKTPGKSDNILYSKWLPQDDI
LAHPKIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPANADAMVKKGFGLTQSLLTLEE
QPFREGIEEILSNPTYSQAVSTFSKLYRDRPLTARESVIYWSEYVIRHHGAAHLQSPLMH
MSFVAANNLDVFALLAIILVVFLLLTKAVIKFIIRKLSSKPKKVKKQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgaatcttgttgctagcggtagctgccgtcgccctaatcggtggaggccaggga
gccaacattctgggattgtttaccagcctaagtccctcccatttgatcattcagatgtcg
gcggccaaggctctcgcggagcggggacataatgtcacggtggtcacagtcctggagccg
gccatcacccacaaggacatcaatctgattcaagtgcctctgagcgaggaggatacggag
cacatgagcagagtctttgagaaaatggggaagaacaacgacaaaaacatgctatttgcc
atgttccgtatgttcggacacatgcggtttatgttccacaaaatagccgatgccctgaag
gacacgcgagtgcgcgatctctacgtgaacaaggacaacagattcgatctggtgctgtcg
ggctttgccttgaacgactaccagatgggttttgcccagaagctaaaggctcccgtgatc
gtagtggccaccctgcccccgagccccttgttcaactacctgattggcaacccggaagag
ccgtcctgtgtccctagcatcaatgattcggtggaaaagggaaagggcttgagctttggc
cagcgcctcagcagctacctgacgggcattggctataaggtcttttcaaaaatgggagag
atacaaaacaaaaaggcttacaaagaagtctttggcgatgatccccatatgcccgagtat
tcggagatgatgaagaatgtatccctcgtgttctttgcctcccacgcaatcagcgaggga
cccattcgacccaatgttcccggtgtgattgagattggtggcattcaaatcaaggacacc
cctactccactgcccccgaacatagaggagttcgtggggaacgccacggatggcgctata
ctcctcagtctgggatccaatgtgcagggatcgcatctcagccccgacaccgtccaaaag
atgttcaatgtcctctcgaaactgaagcagagggtcatctggaagtgggaggacctggac
aagacccctggcaagtcggacaacatcctctactccaagtggcttccacaggatgacatc
ctcgcccatcccaagatcaaactattcatcaatcacgccggaaaaggaggcatcactgag
gcccaataccatggaaagcccatgttatcccttcccgtctttggcgatcaacccgcgaac
gccgatgccatggtcaagaagggctttggcctcactcagagtctcctaaccctcgaggag
cagccgttccgcgagggcatcgaggagatcctctcaaatcccacatactcccaggcagtg
tccaccttttccaaactctatcgcgatcgtccactcactgcccgggaatcggtcatctac
tggtccgaatatgttatccgtcaccatggtgccgctcatctccagagtcctctgatgcac
atgagcttcgtagcagccaacaacttggatgtctttgctcttttggccatcattctcgtt
gttttcctgctactgacgaaggctgttattaaattcatcatcagaaagctctcctcgaag
ccaaagaaggtcaagaaacagtaa

DBGET integrated database retrieval system