KEGG   Drosophila persimilis: Dper_GL26411Help
Entry
Dper_GL26411      CDS       T01063                                 

Definition
GL26411 gene product from transcript GL26411-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dpe  Drosophila persimilis
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dper_GL26411
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dper_GL26411
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dper_GL26411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MRLRSGILLVVLLTIFLEVADCSWPWPFSRKHKQNVPPPPPTPQPEPKMSPVIFVPGDGG
SQLDARLNKSSAPYFVCEKTHDWFNLWLDLEQLVIPMVYCWIDNVKLYYDKATRTTHNTP
GVETRIPGWGNPEVVEWIDPTRNSAGAYFKDIANVLVGMGYERKLNIRGAPFDFRRAPNE
NKQFFIDLKQLVEETYEVNNQSAVTFISHSMGSPMTLVFLQQQTLEWKNKYVRRQISLAG
AWAGSVKAVKVFAMGDDLDSFALSAKILRAEQITHPSSAWLLPSPLFWKPCDVLATTPSR
NYTMAQLKEFFNDIDYMTGWEMRKDTLRYTQNFSPPDVELHCLYGDGIDTVERLQYKKND
IAGETPKLIMGPGDGTVNQRSLRACKYWSGYTSSPISTLALQGVDHMKILSHEDVLQYIR
TVMQQP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagactccgctctggtatccttctggtggtgctactgaccatctttttggaagtagcg
gactgctcgtggccctggccattttccaggaagcacaagcagaatgtgcctccgccgcca
cccacgccccagccagagcccaaaatgtccccagtaatatttgtgccaggtgatggtggc
tcccagctcgatgcccgcttgaacaagtcgagtgctccctacttcgtgtgcgagaagacc
catgactggttcaatctctggctcgacctggagcagctggtgattccaatggtgtactgc
tggatagacaatgtcaagttgtactacgacaaggccactcgtacaacgcacaataccccg
ggagtggagacacgcatacctggttggggcaatcccgaggtggttgagtggatagatccg
acgcggaacagtgctggagcgtatttcaaggacatcgctaacgtgctcgtgggcatgggc
tatgagcggaaactgaacatacgcggagcacccttcgacttccgcagagcaccaaatgag
aacaaacagttcttcatcgacctcaagcagcttgtcgaggagacctacgaggtgaacaac
cagtcagccgtcaccttcatatcgcacagcatgggcagtcccatgacactagttttcctg
cagcaacagaccctcgagtggaagaacaagtatgtgcggcggcagataagtctcgccggc
gcgtgggctggcagcgtaaaggcagtgaaagtctttgctatgggcgatgatctggactcg
tttgctctgagtgccaagatcctgagggctgagcagattacgcatccttcgtcggcctgg
ctactgccatcaccgttgttctggaagccatgcgatgttctggccacgaccccctctcgt
aactatactatggcacagctcaaagagttcttcaacgacattgactacatgacgggctgg
gaaatgcgcaaggacacgttgcgctatacccaaaacttcagtccccccgatgtggagctg
cactgcctatacggcgacgggatagacacagtggaaagattacagtacaaaaagaacgat
attgctggagaaacgcccaagctgatcatgggtccgggcgatggcactgtgaaccagcga
tccctacgggcctgcaagtactggtcgggctacacgagctcccccatatcgacgctggcc
ctgcagggagtggaccacatgaagatcctatcgcatgaagatgttctccaatatattcgc
actgtcatgcagcagccgtag

DBGET integrated database retrieval system